NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17317.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17317.1 Public Mus musculus 3 Il21 19 105 81 CCDS HistoryNCBI Gene:60505Re-query CCDS DB by CCDS ID:17317.1Re-query CCDS DB by GeneID:60505See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17317.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029273 ENSMUSP00000029273 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029273Link to Ensembl Protein Viewer:ENSMUSP00000029273Re-query CCDS DB by Nucleotide ID:ENSMUST00000029273Re-query CCDS DB by Protein ID:ENSMUSP00000029273
Original member Current member EBI,WTSI OTTMUST00000016999 OTTMUSP00000007838 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000016999Link to Vega Protein Viewer:OTTMUSP00000007838Re-query CCDS DB by Nucleotide ID:OTTMUST00000016999Re-query CCDS DB by Protein ID:OTTMUSP00000007838
Original member Current member NCBI NM_021782.3 NP_068554.1 Accepted alive Link to Nucleotide Sequence:NM_021782.3Link to Protein Sequence:NP_068554.1Re-query CCDS DB by Nucleotide ID:NM_021782Re-query CCDS DB by Protein ID:NP_068554Link to BLink:NP_068554.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068554.1 146 Q9ES17 146 100% 0 0

Chromosomal Locations for CCDS 17317.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 37225337 37225360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 37225449 37225526 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 37227655 37227810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 37232267 37232302 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 37232419 37232565 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (441 nt):
ATGGAGAGGACCCTTGTCTGTCTGGTAGTCATCTTCTTGGGGACAGTGGCCCATAAATCAAGCCCCCAAG
GG
CCAGATCGCCTCCTGATTAGACTTCGTCACCTTATTGACATTGTTGAACAGCTGAAAATCTATGAAAA
T
GACTTGGATCCTGAACTTCTATCAGCTCCACAAGATGTAAAGGGGCACTGTGAGCATGCAGCTTTTGCC
TGT
TTTCAGAAGGCCAAACTCAAGCCATCAAACCCTGGAAACAATAAGACATTCATCATTGACCTCGTGG
CC
CAGCTCAGGAGGAGGCTGCCTGCCAGGAGGGGAGGAAAGAAACAGAAGCACATAGCTAAATGCCCTTC
C
TGTGATTCGTATGAGAAAAGGACACCCAAAGAATTCCTAGAAAGACTAAAATGGCTCCTTCAAAAGATG
ATT
CATCAGCATCTCTCCTAG


Translation (146 aa):
MERTLVCLVVIFLGTVAHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFA
C
FQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIA
KCPSCDSYEKRTPKEFLERLKWLLQKM
I
HQHLS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser