NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15439.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15439.1 Public Mus musculus 1 Tbx19 19 105 81 CCDS HistoryNCBI Gene:83993Re-query CCDS DB by CCDS ID:15439.1Re-query CCDS DB by GeneID:83993See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15439.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027859 ENSMUSP00000027859 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027859Link to Ensembl Protein Viewer:ENSMUSP00000027859Re-query CCDS DB by Nucleotide ID:ENSMUST00000027859Re-query CCDS DB by Protein ID:ENSMUSP00000027859
Original member Current member EBI,WTSI OTTMUST00000088588 OTTMUSP00000048294 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000088588Link to Vega Protein Viewer:OTTMUSP00000048294Re-query CCDS DB by Nucleotide ID:OTTMUST00000088588Re-query CCDS DB by Protein ID:OTTMUSP00000048294
Original member Current member NCBI NM_032005.4 NP_114394.1 Accepted alive Link to Nucleotide Sequence:NM_032005.4Link to Protein Sequence:NP_114394.1Re-query CCDS DB by Nucleotide ID:NM_032005Re-query CCDS DB by Protein ID:NP_114394Link to BLink:NP_114394.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_114394.1 446 Q99ME7 446 100% 0 0

Chromosomal Locations for CCDS 15439.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 165138963 165139257 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 165140131 165140266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 165142409 165142597 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 165145056 165145117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 165147635 165147696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 165152002 165152136 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 165153462 165153726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 165160366 165160562 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1341 nt):
ATGAGTGAACTGGCCACACAGAAGGCTGGCGAAGGCACTGTGTCTCGCCTGCTTAACGTGGTGGAAAGTG
AG
CTCCAGGCAGGGAGGGAGAAGGGAGACCCTACAGAGAAGCAACTTCAGATCATCCTGGAGGATGCTCC
C
CTCTGGCAGAGATTCAAGGAAGTCACTAATGAAATGATCGTGACCAAGAACGGCAGACGGATGTTCCCT
GTC
CTGAAGATTAGTGTCACAGGGCTGGACCCCAATGCTATGTACTCTCTCCTACTGGACTTCGTCCGGA
CC
GACAGTCACCGCTGGAAGTACGTCAATGGTGAATGGGTCCCCGCAGGCAAGCCAGAGGTCTCTAGCCA
C
AGCTGTGTCTACATTCACCCCGACTCCCCCAACTTCGGGGCTCACTGGATGAAAGCTCCCATCTCCTTC
AGC
AAAGTGAAGCTGACCAACAAGCTCAATGGAGGTGGGCAGATAATGCTGAATTCTCTGCATAAATATG
AA
CCTCAGGTTCATATAGTCCGTGTTGGAGGCGCCCATCGAATGGTCATGAACTGCTCATTCCCTGAAAC
T
CAGTTCATCGCTGTGACTGCCTATCAGAATGAGGAGATAACAGCTCTCAAAATCAAGTACAACCCTTTC
GCC
AAGGCCTTCTTGGATGCCAAGGAGAGAAACCACCTCAAGGATGTTCCAGAGGCCATCTCTGAGAGCC
AG
CATGTGACCTACTCTCACTTGGGAGGCTGGATCCTTTCCAATCCGGATGGTGTGTGCACAGCAGCAAA
C
AGCAATTACCAGTATGCTACGCCTTTGCCTCTGCCTGCTCCCCACACACACCATGGCTGTGAGCACTAC
GCT
GGCCTCCGAGGTCATCGGCAGGCTCCCTACCCTTCTGCCTACATGCATAGAAACCATTCTCCCTCAG
TG
AATTTGATAGAAAGCTCAAGCAACAATCTGCAAGTTTTCTCGGGACCTGACAGCTGGACTTCCTTATC
C
TCCACACCCCATGCCAGCATCCTGTCTGTACCCCACAGCAATGGCCCAATCAACCCAGGGCCCAGCCCC
TAT
CCGTGCCTGTGGACCATTAGCAATGGAGGTGGGGGCCCCGTGGCATCAGGCTCAGAGGTGCACGCCA
GC
ACCTCAGGAACAATTCTCCTTGGGAACCCTGCTGTCACTTCACCTTCCTCTTTGCTCCCCACCCAAGC
G
ACCACTTCAGCTGGTGTGGAGGTCTTGGGTGAACCTTCACTAACCAGCATTGCTGTGTCCACCTGGACA
GCC
GTGGCCTCACACCCCCTCCCAGGCTGGGGTGGCCCAGGTGGAGCTGGGCGCCATTCTTCCTCTTCAT
TG
GATAGTTAG


Translation (446 aa):
MSELATQKAGEGTVSRLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFP
V
LKISVTGLDPNAMYSLLLDFVRTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISF
S
KVKLTNKLNGGGQ
IMLNSLHKYEPQVHIVRVGGAHRMVMNCSFPETQFIAVTAYQNEEITALKIKYNPF
A
KAFLDAKE
RNHLKDVPEAISESQHVTYSHLGGWILSNPDGVCTAANSNYQYATPLPLPAPHTHHGCEHY
A
GLRGHRQAPYPSAYMHRNHSPS
VNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHSNGPINPGPSP
Y
PCLWTISNGGGGPVASGSEVHASTSGTILLGNPAVTSPSSLLPTQATTSAGVEVLGEPSLTSIAVSTWT
A
VASHPLPGWGGPGGAGRHSSSSLDS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser