NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28163.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28163.1 Public Mus musculus 16 Gsk3b 16 104 75 CCDS HistoryNCBI Gene:56637Re-query CCDS DB by CCDS ID:28163.1Re-query CCDS DB by GeneID:56637

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28163.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023507 ENSMUSP00000023507 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023507Link to Ensembl Protein Viewer:ENSMUSP00000023507Re-query CCDS DB by Nucleotide ID:ENSMUST00000023507Re-query CCDS DB by Protein ID:ENSMUSP00000023507
Original member Current member EBI,WTSI OTTMUST00000039047 OTTMUSP00000017445 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039047Link to Vega Protein Viewer:OTTMUSP00000017445Re-query CCDS DB by Nucleotide ID:OTTMUST00000039047Re-query CCDS DB by Protein ID:OTTMUSP00000017445
Original member Current member NCBI NM_019827.6 NP_062801.1 Accepted alive Link to Nucleotide Sequence:NM_019827.6Link to Protein Sequence:NP_062801.1Re-query CCDS DB by Nucleotide ID:NM_019827Re-query CCDS DB by Protein ID:NP_062801Link to BLink:NP_062801.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062801.1 420 Q9WV60 420 100% 0 0

Chromosomal Locations for CCDS 28163.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

Chromosome Start Stop Links
16 38090526 38090613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38144260 38144453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38170664 38170747 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38184435 38184545 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38187811 38187941 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38191528 38191634 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38193897 38193994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38207995 38208090 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38219972 38220158 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38228678 38228776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38240502 38240569 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1263 nt):
ATGTCGGGGCGACCGAGAACCACCTCCTTTGCGGAGAGCTGCAAGCCAGTGCAGCAGCCTTCAGCTTTTG
GT
AGCATGAAAGTTAGCAGAGATAAAGATGGCAGCAAGGTAACCACAGTAGTGGCAACTCCTGGCCAGGG
T
CCTGACAGGCCACAGGAAGTCAGTTATACAGACACGAAAGTGATTGGAAATGGATCATTTGGTGTGGTA
TAT
CAAGCCAAACTTTGTGATTCTGGAGAACTGGTTGCCATCAAGAAAGTTCTACAGGACAAGCGATTTA
AG
AACCGAGAGCTCCAGATCATGAGAAAGCTAGACCACTGTAACATAGTCCGACTGCGGTATTTCTTCTA
C
TCGAGTGGTGAGAAGAAAGATGAGGTCTACCTTAACCTGGTGCTGGACTATGTTCCGGAGACAGTGTAC
AGA
GTCGCCAGACACTATAGTCGAGCCAAGCAGACACTCCCTGTGATCTATGTCAAGTTGTATATGTATC
AG
CTGTTCAGAAGTCTAGCCTATATCCATTCCTTTGGAATCTGCCATCGAGACATTAAACCACAGAACCT
C
TTGTTGGATCCTGATACAGCTGTATTAAAACTCTGTGACTTTGGAAGTGCAAAGCAGCTGGTCCGAGGA
GAG
CCCAATGTTTCATATATCTGTTCTCGGTACTACAGGGCACCAGAGTTGATCTTTGGAGCCACTGATT
AC
ACGTCCAGTATAGATGTATGGTCTGCAGGCTGTGTGTTGGCTGAATTGTTGCTAGGACAACCAATATT
T
CCTGGGGACAGTGGTGTGGATCAGTTGGTGGAAATAATAAAGGTCCTAGGAACACCAACAAGGGAGCAA
ATT
AGAGAAATGAACCCAAATTATACAGAATTCAAATTCCCTCAAATCAAGGCACATCCTTGGACAAAGG
TC
TTCCGGCCCCGAACTCCACCAGAGGCAATTGCACTGTGCAGCCGTCTGCTGGAGTACACACCTACCGC
C
CGGCTAACACCACTGGAAGCTTGTGCACATTCATTTTTCGATGAATTGCGGGACCCAAATGTCAAACTA
CCA
AATGGGCGAGACACACCTGCACTCTTCAACTTTACCACTCAAGAACTGTCAAGTAACCCCCCTCTGG
CC
ACCATCCTTATCCCTCCACATGCTCGGATTCAGGCCGCTGCTTCACCGCCTGCCAACGCCACAGCAGC
C
TCAGATACTAATGCTGGAGACCGTGGACAGACCAATAACGCCGCTTCTGCATCAGCTTCCAACTCCACC
TGA


Translation (420 aa):
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV
Y
QAKLCDSGELVAIKKVLQDKRFK
NRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY
R
VARHYSRAKQTLPVIYVK
LYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG
E
PNVSYICSRYYRAPELIFGATDYTSSI
DVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ
I
REMNPNYTEFKFPQIKAHPWTK
VFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL
P
NGRDTPALFNFTTQ
ELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser