NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36957.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36957.1 Public Mus musculus 14 Clu 16 104 75 CCDS HistoryNCBI Gene:12759Re-query CCDS DB by CCDS ID:36957.1Re-query CCDS DB by GeneID:12759See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36957.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022616 ENSMUSP00000022616 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022616Link to Ensembl Protein Viewer:ENSMUSP00000022616Re-query CCDS DB by Nucleotide ID:ENSMUST00000022616Re-query CCDS DB by Protein ID:ENSMUSP00000022616
Original member Current member EBI,WTSI OTTMUST00000081231 OTTMUSP00000043417 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081231Link to Vega Protein Viewer:OTTMUSP00000043417Re-query CCDS DB by Nucleotide ID:OTTMUST00000081231Re-query CCDS DB by Protein ID:OTTMUSP00000043417
Original member Current member NCBI NM_013492.2 NP_038520.2 Accepted alive Link to Nucleotide Sequence:NM_013492.2Link to Protein Sequence:NP_038520.2Re-query CCDS DB by Nucleotide ID:NM_013492Re-query CCDS DB by Protein ID:NP_038520Link to BLink:NP_038520.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038520.2 448 Q06890 448 100% 0 0

Chromosomal Locations for CCDS 36957.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 65971759 65971852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 65973325 65973473 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 65974843 65975013 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 65975581 65975992 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 65976906 65977010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 65979651 65979880 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 65980854 65981029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 65981308 65981317 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1347 nt):
ATGAAGATTCTCCTGCTGTGCGTGGCACTGCTGCTGATCTGGGACAATGGCATGGTCCTGGGAGAGCAGG
AG
GTCTCTGACAATGAGCTCCAAGAACTGTCCACTCAAGGGAGTAGGTATATTAATAAGGAGATTCAGAA
C
GCCGTCCAGGGAGTGAAGCACATAAAAACTCTCATAGAAAAAACCAACGCAGAGCGCAAGTCCTTGCTC
AAC
AGTTTAGAGGAAGCCAAGAAGAAGAAAGAGGATGCTCTGGAGGACACTAGGGATTCTGAAATGAAGC
TG
AAGGCATTCCCGGAAGTGTGTAACGAGACCATGATGGCCCTCTGGGAGGAGTGCAAGCCCTGCCTGAA
G
CATACCTGCATGAAGTTCTATGCACGTGTCTGCAGGAGCGGCTCAGGGCTGGTCGGCCAGCAGCTAGAG
GAG
TTTCTAAACCAGAGCTCACCCTTCTACTTCTGGATGAACGGCGACCGCATCGACTCCCTGCTGGAGA
GT
GACCGGCAGCAGAGCCAAGTCCTGGATGCCATGCAGGACAGCTTTGCTCGGGCATCTGGCATCATAGA
C
ACGCTCTTTCAGGACCGGTTCTTCGCCCGTGAGCTTCATGACCCCCACTACTTCTCCCCCATCGGCTTC
CCA
CACAAGAGGCCTCATTTCTTATATCCCAAGTCCCGCTTGGTCCGCAGCCTCATGTCTCCCTCCCACT
AT
GGGCCTCCGAGCTTCCACAACATGTTCCAGCCTTTCTTTGAGATGATCCACCAGGCTCAACAGGCCAT
G
GATGTCCAGCTCCACAGCCCAGCCTTCCAGTTCCCAGACGTGGATTTCTTAAGAGAAGGTGAAGATGAC
CGC
ACTGTGTGCAAGGAGATCCGCCGCAACTCCACAGGATGCCTGAAGATGAAGGGCCAGTGTGAAAAGT
GC
CAGGAGATCTTGTCTGTGGACTGTTCAACCAACAATCCTGCCCAGGCTAACCTGCGCCAGGAGCTGAA
C
GACTCGCTCCAGGTGGCCGAGAGGCTGACAGAGCAGTACAAGGAGCTGCTGCAGTCCTTCCAGTCGAAG
ATG
CTCAACACCTCATCCCTGCTGGAGCAGCTGAACGACCAGTTCAACTGGGTGTCCCAGCTGGCTAACC
TC
ACACAGGGCGAAGACAAGTACTACCTTCGGGTCTCCACCGTGACCACCCATTCCTCTGACTCAGAGGT
C
CCCTCCCGTGTCACTGAGGTGGTGGTGAAGCTGTTTGACTCTGACCCCATCACAGTGGTGTTACCAGAA
GAA
GTCTCTAAGGATAACCCTAAGTTTATGGACACAGTGGCGGAGAAGGCGCTACAGGAATACCGCAGGA
AA
AGCCGTGCGGAATGA


Translation (448 aa):
MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLL
N
SLEEAKKKKE
DALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLE
E
FLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGF
P
HKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLR
EGEDD
R
TVCKEIRRNSTGCLKMKGQCEKCQEILSV
DCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSK
M
LNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVST
VTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPE
E
VSKDNPKFMDTVAEKALQEYRRKS
RAE



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser