NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26904.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26904.1 Public Mus musculus 14 Glt8d1 16 104 75 CCDS HistoryNCBI Gene:76485Re-query CCDS DB by CCDS ID:26904.1Re-query CCDS DB by GeneID:76485See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26904.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022476 ENSMUSP00000022476 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022476Link to Ensembl Protein Viewer:ENSMUSP00000022476Re-query CCDS DB by Nucleotide ID:ENSMUST00000022476Re-query CCDS DB by Protein ID:ENSMUSP00000022476
Original member Current member EBI,WTSI ENSMUST00000168584 ENSMUSP00000129323 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168584Link to Ensembl Protein Viewer:ENSMUSP00000129323Re-query CCDS DB by Nucleotide ID:ENSMUST00000168584Re-query CCDS DB by Protein ID:ENSMUSP00000129323
Original member Current member NCBI NM_001165930.1 NP_001159402.1 Accepted alive Link to Nucleotide Sequence:NM_001165930.1Link to Protein Sequence:NP_001159402.1Re-query CCDS DB by Nucleotide ID:NM_001165930Re-query CCDS DB by Protein ID:NP_001159402Link to BLink:NP_001159402.1
Original member Current member NCBI NM_029626.2 NP_083902.2 Accepted alive Link to Nucleotide Sequence:NM_029626.2Link to Protein Sequence:NP_083902.2Re-query CCDS DB by Nucleotide ID:NM_029626Re-query CCDS DB by Protein ID:NP_083902Link to BLink:NP_083902.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001159402.1 371 Q6NSU3-1 371 100% 0 0
NP_083902.2 371 Q6NSU3-1 371 100% 0 0

Chromosomal Locations for CCDS 26904.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 31006497 31006512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31006633 31006731 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31008654 31008867 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31009735 31009852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31010081 31010165 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31010297 31010409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31010864 31011030 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31011121 31011233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31011485 31011675 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1116 nt):
ATGTCATTCCGTAAAGTGAACATCATCATCTGGGTCCTGGCTGTTGTTCTCTTCTTACTGGTTTTGCACC
AT
AACTTCCTCAGCTTGAGCAGTTTGTTAAAGAATGACATTTCAGATTCGGGAATTGTGGGGCTTCAGCC
C
ATAGACTTTGTCGCCAGTGCTCATCAGCATCCAGTGAGTGAGAGGCAAGAGGAGATTCCCGTGGTTATT
GCT
GCCTCTGAAGACAGGCTGGGTGGGACCATTGCAGCCATAAACAGCGTTCATCAAAACACGCGCTCCA
AT
GTGATGTTTTACATTGTTACATTCAACAGCACAGCAGACCATCTCCGGTCCTGGCTTAACAGTGGTTC
C
TTGAAAAGCATCAGGTACAAAATTGTAAATTTTGACACTAAACTTTTGGAAGGGAAAGTAAAGCAGGAT
CCT
GACCAGGGGGAGTCCATGAAACCATTAACCTTTGCAAGGTTCTACTTGCCAATTCTGGTTCCCAGTG
CA
AAGAAAGCCATATACATGGATGATGATGTCATTGTACAAGGTGACATACTTGCCTTGTACAATACACC
A
CTGAAGCCAGGACATGCTGCTGCGTTTTCAGAAGATTGTGACTCAGCCTCCACTAAAGTCATCATCCGG
GGA
GCAGGGAACCAGTACAATTACATTGGTTATCTTGACTATAAAAAGGAAAGAATTCGTAAACTTTCCA
TG
AAAGCCAGCACCTGTTCCTTTAATCCTGGAGTTTTTGTTGCAAACTTGACTGAATGGAAAAGACAGAA
T
GTAACTAACCAGTTGGAAAAATGGATGAAGCTCAATGTAGAAGAGGGATTATACAGCAGAACTCTGGCA
GGC
AGCATCACCACACCTCCTCTGCTTATCGTATTTTATCAGCAGCATTCCACCATTGACCCTATGTGGA
AT
GTCCGCCATCTTGGTTCCAGTGCTGGAAAACGGTACTCACCCCAGTTTGTAAAAGCTGCCAAGTTACT
T
CACTGGAATGGTCACTTCAAGCCTTGGGGAAGAACTGCTTCATATGCTGATGTTTGGGAAAAGTGGTAT
ATT
CCAGACCCAACAGGAAAATTCAGTTTAATCCGAAGACATATGGATACCTCAAACATAAAGTGA


Translation (371 aa):
MSFRKVNIIIWVLAVVLFLLVLHHNFLSLSSLLKNDISDSGIVGLQPIDFVASAHQHPVSERQEEIPVVI
A
ASEDRLGGTIAAINSVHQNTRSNVMFYIVTFNSTADHL
RSWLNSGSLKSIRYKIVNFDTKLLEGKVKQD
P
DQGESMKP
LTFARFYLPILVPSAKKAIYMDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSASTKVIIR
G
AGNQ
YNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNVTNQLEKWMKLNVEEGLYSRTLA
G
SITTPPLLIVFYQQHSTIDPMWNVRHL
GSSAGKRYSPQFVKAAKLLHWNGHFKPWGRTASYADVWEKWY
I
PDPTGKFSLIRRHMDTSNIK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser