NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24575.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24575.2 Public Mus musculus 11 Itk 16 104 75 CCDS HistoryNCBI Gene:16428Re-query CCDS DB by CCDS ID:24575.2Re-query CCDS DB by GeneID:16428

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24575.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020664 ENSMUSP00000020664 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020664Link to Ensembl Protein Viewer:ENSMUSP00000020664Re-query CCDS DB by Nucleotide ID:ENSMUST00000020664Re-query CCDS DB by Protein ID:ENSMUSP00000020664
Original member Current member EBI,WTSI OTTMUST00000012226 OTTMUSP00000005641 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012226Link to Vega Protein Viewer:OTTMUSP00000005641Re-query CCDS DB by Nucleotide ID:OTTMUST00000012226Re-query CCDS DB by Protein ID:OTTMUSP00000005641
Original member Current member NCBI NM_010583.3 NP_034713.2 Accepted alive Link to Nucleotide Sequence:NM_010583.3Link to Protein Sequence:NP_034713.2Re-query CCDS DB by Nucleotide ID:NM_010583Re-query CCDS DB by Protein ID:NP_034713Link to BLink:NP_034713.2

Chromosomal Locations for CCDS 24575.2

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 46327457 46327528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46331835 46331992 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46334875 46334993 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46335078 46335142 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46336349 46336565 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46338105 46338276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46340653 46340727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46341107 46341237 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46342398 46342480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46347871 46347925 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46353877 46353942 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46355725 46355876 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46360281 46360321 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46363797 46363925 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46365976 46366057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46367831 46367935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 46389273 46389410 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1860 nt):
ATGAACAACTTCATCCTCCTGGAAGAACAGCTGATCAAGAAGTCCCAACAGAAGAGAAGGACTTCTCCCT
CG
AATTTTAAAGTTCGTTTCTTTGTCTTAACGAAAGCCAGCCTGGCCTACTTTGAGGACCGCCACGGGAA
G
AAGCGCACGTTGAAGGGCTCCATTGAACTCTCCAGAATCAAGTGTGTGGAGATTGTCAAGAGTGACATT
AGC
ATCCCGTGCCACTATAAATACCCTTTTCAGGTCGTGCATGACAACTATCTCCTGTATGTGTTTGCTC
CA
GACTGTGAGAGTCGGCAGCGCTGGGTGCTGACCCTTAAAGAAGAAACGAGGAATAACAACAGCCTGGT
A
TCCAAGTATCACCCTAATTTCTGGATGGATGGGCGGTGGAGGTGCTGCTCCCAGCTGGAGAAGCCTGCT
GTA
GGCTGTGCTCCCTACGACCCATCCAAGAATGCTTCAAAGAAGCCTCTTCCTCCTACTCCTGAAGACA
AC
AGGCGGTCATTTCAGGAACCTGAAGAAACCCTGGTCATTGCCTTGTACGACTACCAAACCAACGACCC
T
CAGGAGCTCGCACTGCGGTGTGATGAAGAGTACTACCTGCTGGACAGCTCCGAGATCCACTGGTGGAGG
GTT
CAAGACAAAAATGGGCATGAAGGATATGCACCAAGCAGTTACCTGGTAGAAAAATCTCCAAATAACC
TT
GAAACCTATGAGTGGTACAATAAAAGCATCAGCCGCGACAAAGCTGAAAAACTTCTTTTGGACACAGG
T
AAAGAAGGAGCTTTCATGGTCCGAGATTCCAGGACACCCGGGACATACACAGTCTCTGTTTTCACCAAG
GCC
ATCATAAGTGAGAACCCCTGTATAAAACATTATCACATCAAAGAAACAAATGACAGCCCCAAGCGCT
AC
TACGTGGCTGAGAAGTATGTGTTTGACTCCATCCCTCTCCTCATCCAGTATCACCAGTACAATGGAGG
A
GGTTTGGTCACTCGACTCCGCTATCCAGTTTGCTCCTGGAGACAAAAAGCCCCTGTCACAGCAGGGCTA
AGA
TATGGGAAGTGGGTGATCCAACCCTCAGAGCTAACGTTCGTGCAGGAGATTGGCAGCGGGCAGTTTG
GG
CTGGTGCATCTCGGCTACTGGCTCAACAAGGACAAGGTGGCCATCAAGACCATTCAGGAAGGGGCGAT
G
TCAGAAGAAGACTTTATCGAGGAGGCGGAAGTCATGATGAAACTCTCTCACCCCAAACTGGTGCAGCTC
TAT
GGGGTGTGCCTGGAGCAAGCCCCCATCTGCCTGGTGTTTGAGTTCATGGAGCACGGCTGCCTGTCGG
AT
TACCTTCGAAGTCAGCGGGGTCTCTTTGCTGCGGAGACCCTGCTGGGCATGTGCCTGGATGTGTGTGA
G
GGCATGGCCTACCTGGAAAAAGCTTGTGTCATCCACAGAGACCTGGCAGCCAGAAACTGTTTGGTGGGA
GAA
AACCAGGTCATCAAGGTGTCCGACTTTGGGATGACAAGATTTGTCCTTGATGATCAATATACCAGCT
CC
ACGGGCACCAAATTCCCAGTGAAGTGGGCATCCCCAGAGGTGTTCTCCTTTAGTCGCTATAGCAGCAA
G
TCAGATGTGTGGTCGTTTGGTGTACTGATGTGGGAAGTCTTCAGTGAAGGCAAAATCCCATACGAAAAC
CGA
AGCAATTCCGAGGTCGTGGAAGATATCAGCACTGGCTTTCGGTTATACAAGCCCCGCCTGGCCTCCT
GT
CATGTCTACCAGATCATGAATCATTGCTGGAAAGAGAAACCAGAAGACCGGCCACCCTTCTCCCAGCT
G
TTAAGCCAGCTGGCTGAAATCGCAGAAGCTGGGCTTTAG


Translation (619 aa):
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDI
S
IPCHYKYPFQ
VVHDNYLLYVFAPDCESRQRWVLTLKEETRNNNSLVSKYHPNFWMDGRWRCCSQLEKPA
V
GCAPYDPSKN
ASKKPLPPTPEDNRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWR
V
QDKN
GHEGYAPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTK
A
II
SENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCSWRQKAPVTAGL
R
Y
GKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQL
Y
GVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDL
AARNCLVG
E
NQVIKVSDFGMT
RFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYEN
R
SNSEVVEDISTGFRLYKPRLASCHVYQIMNHCWKE
KPEDRPPFSQLLSQLAEIAEAGL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser