NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25544.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25544.1 Public Mus musculus 11 Ace 16 104 75 CCDS HistoryNCBI Gene:11421Re-query CCDS DB by CCDS ID:25544.1Re-query CCDS DB by GeneID:11421See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25544.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000001964 ENSMUSP00000001964 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000001964Link to Ensembl Protein Viewer:ENSMUSP00000001964Re-query CCDS DB by Nucleotide ID:ENSMUST00000001964Re-query CCDS DB by Protein ID:ENSMUSP00000001964
Original member Current member EBI,WTSI OTTMUST00000006417 OTTMUSP00000003023 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000006417Link to Vega Protein Viewer:OTTMUSP00000003023Re-query CCDS DB by Nucleotide ID:OTTMUST00000006417Re-query CCDS DB by Protein ID:OTTMUSP00000003023
Original member Current member NCBI NM_009598.2 NP_033728.1 Accepted alive Link to Nucleotide Sequence:NM_009598.2Link to Protein Sequence:NP_033728.1Re-query CCDS DB by Nucleotide ID:NM_009598Re-query CCDS DB by Protein ID:NP_033728Link to BLink:NP_033728.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033728.1 732 P09470-2 732 100% 0 0

Chromosomal Locations for CCDS 25544.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 105975208 105975403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105975536 105975672 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105976545 105976703 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105976952 105977039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105979170 105979313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105979481 105979672 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105981498 105981595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105981768 105981940 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105985045 105985268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105985573 105985717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105985990 105986088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105988016 105988138 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105988429 105988616 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 105988802 105989034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2199 nt):
ATGGGCCAAGGTTGGGCTACTCCAGGACTGCCCAGCTTCCTCTTTCTGCTGCTCTGCTGTGGGCACCATC
TG
CTGGTCCTGAGTCAGGTGGCCACTGACCACGTGACAGCCAACCAGGGGATAACAAACCAGGCAACAAC
C
AGAAGCCAGACAACAACTCACCAAGCAACCATTGACCAGACAACCCAGATCCCAAACCTAGAGACTGAT
GAA
GCCAAGGCTGACAGGTTCGTGGAAGAGTATGACCGGACAGCCCAAGTGTTGTTGAACGAGTACGCAG
AG
GCCAACTGGCAATATAACACCAACATTACCATAGAGGGCAGCAAGATCCTGCTTGAGAAAAGCACGGA
G
GTATCCAATCACACCCTGAAATATGGCACCCGGGCCAAGACATTTGATGTGAGCAACTTTCAAAACTCT
TCC
ATCAAGCGGATCATAAAGAAGCTTCAGAACCTGGACCGGGCAGTGCTGCCTCCCAAGGAATTAGAAG
AG
TACAACCAGATCCTGCTAGACATGGAGACAACTTACAGCTTATCCAACATTTGCTACACAAATGGCAC
T
TGTATGCCCCTGGAACCTGATCTAACAAACATGATGGCCACATCCCGGAAATATGAAGAATTGCTATGG
GCA
TGGAAGAGCTGGAGAGACAAGGTGGGGAGAGCCATCCTTCCTTTTTTCCCAAAGTATGTGGAGTTCT
CC
AACAAGATTGCCAAGCTCAATGGCTACACGGATGCAGGGGATTCATGGAGATCCTTATACGAGTCTGA
C
AACCTGGAGCAAGACCTGGAAAAACTGTACCAGGAGCTGCAGCCACTCTACCTGAACCTGCATGCCTAT
GTG
CGTCGTTCCCTGCACCGCCACTATGGGTCCGAGTACATCAACCTGGATGGCCCCATTCCTGCCCATC
TG
CTAGGGAACATGTGGGCGCAGACCTGGTCCAACATCTATGATTTGGTGGCGCCCTTCCCTTCCGCCCC
C
AATATAGATGCCACGGAAGCCATGATAAAGCAGGGATGGACACCCAGAAGGATATTTAAGGAAGCTGAC
AAT
TTCTTTACCTCCCTGGGGCTGTTACCTGTGCCCCCTGAGTTCTGGAACAAGTCGATGTTAGAGAAGC
CC
ACCGATGGAAGGGAGGTGGTGTGCCATCCCTCAGCCTGGGACTTCTACAACGGCAAGGACTTCAGGAT
C
AAGCAGTGTACCTCTGTGAACATGGAGGACTTGGTGATAGCGCACCACGAAATGGGCCACATCCAGTAT
TTC
ATGCAGTACAAAGACTTACCCGTGACTTTCCGGGAGGGTGCCAACCCTGGTTTTCATGAAGCTATTG
GA
GATATAATGGCTCTCTCAGTGTCTACCCCCAAGCATCTATACAGTCTCAACCTGCTTAGCACTGAGGG
C
AGTGGCTACGAGTATGACATCAACTTTCTAATGAAGATGGCCCTCGACAAGATCGCCTTTATCCCCTTC
AGC
TACCTCATCGACCAGTGGCGCTGGAGGGTCTTTGATGGAAGCATCACCAAGGAGAACTATAACCAGG
AG
TGGTGGAGCCTCAGGCTGAAGTATCAGGGTCTGTGCCCCCCAGTGCCAAGATCCCAAGGTGACTTTGA
C
CCAGGGTCCAAGTTCCACGTTCCTGCGAACGTGCCATACGTCAGGTACTTTGTCAGCTTCATCATCCAG
TTC
CAGTTCCACGAGGCGCTGTGTCGCGCAGCCGGGCACACGGGTCCCCTGCACAAGTGTGACATCTACC
AA
TCCAAGGAAGCAGGGAAGCTCCTGGCGGATGCCATGAAGCTGGGCTACAGTAAGCCGTGGCCAGAGGC
C
ATGAAGCTGATCACAGGCCAGCCTAACATGTCAGCCTCCGCCATGATGAATTACTTCAAGCCACTGACA
GAA
TGGCTCGTCACCGAGAACAGGAGACATGGAGAGACACTGGGCTGGCCGGAGTACAACTGGGCGCCAA
AC
ACCGCTCGCGCAGAAGGCTCCACCGCAGAGTCCAACCGCGTCAATTTCCTGGGCCTGTACCTGGAGCC
A
CAGCAGGCCCGCGTGGGCCAGTGGGTGCTGCTCTTCCTGGGCGTCGCCCTGCTCGTGGCCACCGTGGGT
CTC
GCCCATCGGCTCTACAACATCCGTAACCATCACAGCCTCCGCCGGCCCCACCGTGGGCCCCAGTTTG
GG
TCTGAGGTGGAGCTCAGACACTCCTGA


Translation (732 aa):
MGQGWATPGLPSFLFLLLCCGHHLLVLSQVATDHVTANQGITNQATTRSQTTTHQATIDQTTQIPNLETD
E
AKADRFVEEYDRTAQVLLNEYAEANWQYNTNITIEGSKIL
LEKSTEVSNHTLKYGTRAKTFDVSNFQNS
S
IKRIIKKLQNLDRAVLPPKELEE
YNQILLDMETTYSLSNICYTNGTCMPLEPDLTNMMATSRKYEELLW
A
WKSWRDKVGRAILPFFPKYVEFSNKIAKLN
GYTDAGDSWRSLYESDNLEQDLEKLYQELQPLYLNLHAY
V
RRSLHRHYGSEYINLDGPIPAHLL
GNMWAQTWSNIYDLVAPFPSAPNIDATEAMIKQGWTPRRIFKEAD
N
FFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDF
RIKQCTSVNMEDLVIAHHEMGHIQY
F
MQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTEGSGY
EYDINFLMKMALDKIAFIPF
S
YLIDQWRWRVFDGSITKENYNQEWWSL
RLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQ
F
QFHEALCRAAGHTGPLHKCDIYQSKEAGKLL
ADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLT
E
WLVTENRRHGETLGWPEYNWAPNT
ARAEGSTAESNRVNFLGLYLEPQQARVGQWVLLFLGVALLVATVG
L
AHRLYNIRNHHSLRRPHRGPQFGSEVELRHS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser