NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3462.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3462.1 Public Homo sapiens 4 UCHL1 15 105 74 CCDS HistoryNCBI Gene:7345Re-query CCDS DB by CCDS ID:3462.1Re-query CCDS DB by GeneID:7345

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3462.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000284440 ENSP00000284440 Accepted alive Link to Ensembl Transcript Viewer:ENST00000284440Link to Ensembl Protein Viewer:ENSP00000284440Re-query CCDS DB by Nucleotide ID:ENST00000284440Re-query CCDS DB by Protein ID:ENSP00000284440
Original member Current member EBI,WTSI ENST00000503431 ENSP00000422542 Accepted alive Link to Ensembl Transcript Viewer:ENST00000503431Link to Ensembl Protein Viewer:ENSP00000422542Re-query CCDS DB by Nucleotide ID:ENST00000503431Re-query CCDS DB by Protein ID:ENSP00000422542
Original member Current member EBI,WTSI OTTHUMT00000216827 OTTHUMP00000125219 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000216827Link to Vega Protein Viewer:OTTHUMP00000125219Re-query CCDS DB by Nucleotide ID:OTTHUMT00000216827Re-query CCDS DB by Protein ID:OTTHUMP00000125219
Original member Current member EBI,WTSI OTTHUMT00000360473 OTTHUMP00000218137 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000360473Link to Vega Protein Viewer:OTTHUMP00000218137Re-query CCDS DB by Nucleotide ID:OTTHUMT00000360473Re-query CCDS DB by Protein ID:OTTHUMP00000218137
Original member Current member NCBI NM_004181.4 NP_004172.2 Accepted alive Link to Nucleotide Sequence:NM_004181.4Link to Protein Sequence:NP_004172.2Re-query CCDS DB by Nucleotide ID:NM_004181Re-query CCDS DB by Protein ID:NP_004172Link to BLink:NP_004172.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004172.2 223 P09936 223 100% 0 0

Chromosomal Locations for CCDS 3462.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 4 (NC_000004.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 41258994 41259026 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41259132 41259143 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41259626 41259754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41262664 41262814 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41263732 41263817 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41263893 41263940 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41265242 41265308 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41266120 41266178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 41270004 41270090 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (672 nt):
ATGCAGCTCAAGCCGATGGAGATCAACCCCGAGATGCTGAACAAAGTGCTGTCCCGGCTGGGGGTCGCCG
GC
CAGTGGCGCTTCGTGGACGTGCTGGGGCTGGAAGAGGAGTCTCTGGGCTCGGTGCCAGCGCCTGCCTG
C
GCGCTGCTGCTGCTGTTTCCCCTCACGGCCCAGCATGAGAACTTCAGGAAAAAGCAGATTGAAGAGCTG
AAG
GGACAAGAAGTTAGTCCTAAAGTGTACTTCATGAAGCAGACCATTGGGAATTCCTGTGGCACAATCG
GA
CTTATTCACGCAGTGGCCAATAATCAAGACAAACTGGGATTTGAGGATGGATCAGTTCTGAAACAGTT
T
CTTTCTGAAACAGAGAAAATGTCCCCTGAAGACAGAGCAAAATGCTTTGAAAAGAATGAGGCCATACAG
GCA
GCCCATGATGCCGTGGCACAGGAAGGCCAATGTCGGGTAGATGACAAGGTGAATTTCCATTTTATTC
TG
TTTAACAACGTGGATGGCCACCTCTATGAACTTGATGGACGAATGCCTTTTCCGGTGAACCATGGCGC
C
AGTTCAGAGGACACCCTGCTGAAGGACGCTGCCAAGGTCTGCAGAGAATTCACCGAGCGTGAGCAAGGA
GAA
GTCCGCTTCTCTGCCGTGGCTCTCTGCAAGGCAGCCTAA


Translation (223 aa):
MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLTAQHENFRKKQIEEL
K
GQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGF
EDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQ
A
AHDAVAQEGQCR
VDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQG
E
VRFSAVALCKAA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser