NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19148.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19148.1 Public Mus musculus 5 13 103 72 CCDS HistoryNCBI Gene:56873Re-query CCDS DB by CCDS ID:19148.1Re-query CCDS DB by GeneID:56873

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19148.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000055195 ENSMUSP00000058405 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055195Link to Ensembl Protein Viewer:ENSMUSP00000058405Re-query CCDS DB by Nucleotide ID:ENSMUST00000055195Re-query CCDS DB by Protein ID:ENSMUSP00000058405
Original member Current member NCBI NM_020295.3 NP_064691.2 Accepted alive Link to Nucleotide Sequence:NM_020295.3Link to Protein Sequence:NP_064691.2Re-query CCDS DB by Nucleotide ID:NM_020295Re-query CCDS DB by Protein ID:NP_064691Link to BLink:NP_064691.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_064691.2 490 Q9JIT0-1 490 100% 0 0

Chromosomal Locations for CCDS 19148.1

Assembly GRCm38.p1 (GCF_000001635.21)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

Chromosome Start Stop Links
5 29233063 29233148 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29234978 29235139 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29252743 29252809 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29254242 29254332 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29254546 29254619 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29258058 29258135 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29258679 29258755 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29263395 29263475 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29287391 29287463 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29291273 29291337 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29292152 29292220 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29292823 29292949 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29323802 29323905 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29346767 29346906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29361048 29361087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29363883 29363955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 29378127 29378192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1473 nt):
ATGGAAGGGCAGGACGAGGTGTCGGCGCGGGAGCAGCACTTCCACAGCCAAGTGCGAGAGTCCACGATAT
GT
TTTCTTCTCTTTGCCATTCTCTACATCGTTTCCTACTTCATCATTATAAGATACAAGAGAAAATCCGA
T
GAACAAGAAGATGAGGATGCTGTAGTCAACAGGATATCGTTGTTTCTGAGCACCTTCACTCTAGCCGTG
TCA
GCTGGCGCGGTTTTGCTTTTACCCTTCTCAATCATCAGCAATGAGATCCTGCTTGCTTTTCCTCACA
AC
TACTATATTCAGTGGCTGAATGGCTCCCTCATCCACGGTTTGTGGAATCTTGCTTCTTTATTTTCCAA
T
CTTTGTTTATTTGTGTTGATGCCCTTTGCCTTTTTCTTTCTGGAATCAGAAGGTTTTGCAGGCCTGAAA
AAG
GGAATCCGAGCCCGCATTTTGGAAACTCTGGTTATGCTGCTGCTTCTTGCGTTGCTGATTCTTGGGA
TG
GTGTGGGTGGCTTCCGCCCTGATTGACAGTGATGCTGCCAGTATGGAGTCTTTATATGATCTCTGGGA
A
TTCTACTTGCCCTATTTGTATTCTTGCATTTCGCTGATGGGATGCTTGCTGCTTCTCTTGTGTACTCCA
GTT
GGCCTGTCCCGTATGTTCACAGTCATGGGTCAGTTGCTGGTGAAGCCAGCGATTCTTGAAGACCTGG
AT
GAACAAATTTATATGATTACTCTAGAAGAAGAAGCACTCCAGAGAAGACTACATGGGCTATCTTCATC
G
GTGGAGTACAATGTAATGGAATTGGAGCAAGAACTTGAGAATGTAAAGATCCTTAAGACAAAATTAGAG
AGG
AGGAAAAAGGCTTCAGCTTGGGAGAGAAATTTGGTGTATCCTGCTGTTATGGTTCTCCTTCTTATTG
AA
ACATCCATTTCAGTCCTCCTGGTGGCGTGCAATATTCTTTGCCTGCTGGTTGATGAGACTGCAATGCC
A
AAGGGAACAAGGGGCCCCGGCATAGGAAGTGCCTCTCTTTCCACTTTTGGCTTTGTGGGAGCTGCACTT
GAA
ATCATTCTGATTTTCTATCTCATGGTGTCTTCTGTTGTTGGTTTCTATAGCCTCAGATTTTTTGGAA
AC
TTTACACCCAAGAAGGATGACACAACTATGACAAAGATCATTGGGAATTGTGTGTCAATCTTAGTCTT
G
AGCTCTGCTTTGCCTGTGATGTCCAGAACACTGGGAATCACTAGATTCGATCTACTTGGAGACTTTGGA
AGA
TTTAATTGGCTGGGAAATTTCTATATTGTATTATCCTACAATTTACTCTTCGCCATCATGACAACAT
TG
TGTTTGATCAGAAAATTCACATCAGCAGTACGAGAAGAACTTTTCAAGGCCCTAGGACTTCACAAACT
T
CACTTGTCAGATACCTCAAGGGATTCAGAAACTACAAAGCCTTCTGCAAATGGGCATCAGAAAGCACTG
TGA


Translation (490 aa):
MEGQDEVSAREQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTLAV
S
AGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIH
GLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLK
K
GIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTP
V
GLSRMFTVMGQLLVKPA
ILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLE
R
RKKASAWERNLVYPAVMVLLLIET
SISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAAL
E
IILI
FYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFG
R
FNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKAL
GLHKLHLSDTSRDSETTKPSANGHQKAL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser