NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51383.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51383.1 Public Mus musculus 4 Pik3cd 13 103 72 CCDS HistoryNCBI Gene:18707Re-query CCDS DB by CCDS ID:51383.1Re-query CCDS DB by GeneID:18707

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51383.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000038859 ENSMUSP00000036434 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000038859Link to Ensembl Protein Viewer:ENSMUSP00000036434Re-query CCDS DB by Nucleotide ID:ENSMUST00000038859Re-query CCDS DB by Protein ID:ENSMUSP00000036434
Original member Current member EBI,WTSI OTTMUST00000023879 OTTMUSP00000010950 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000023879Link to Vega Protein Viewer:OTTMUSP00000010950Re-query CCDS DB by Nucleotide ID:OTTMUST00000023879Re-query CCDS DB by Protein ID:OTTMUSP00000010950
Original member Current member NCBI NM_001164050.1 NP_001157522.1 Accepted alive Link to Nucleotide Sequence:NM_001164050.1Link to Protein Sequence:NP_001157522.1Re-query CCDS DB by Nucleotide ID:NM_001164050Re-query CCDS DB by Protein ID:NP_001157522Link to BLink:NP_001157522.1

Chromosomal Locations for CCDS 51383.1

Assembly GRCm38.p1 (GCF_000001635.21)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 149650640 149650777 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149651765 149651897 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149652227 149652372 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149652611 149652734 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149653311 149653478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149653807 149653885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149654023 149654138 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149654225 149654403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149654518 149654617 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149654816 149654959 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149655127 149655248 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149655336 149655503 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149655581 149655631 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149656381 149656511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149656604 149656700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149657246 149657467 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149658382 149658471 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149658712 149658861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149658971 149659150 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149659693 149659922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149660002 149660230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 149663144 149663284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3138 nt):
ATGCCCCCTGGGGTGGACTGCCCCATGGAGTTCTGGACCAAAGAGGAGAGCCAGAGCGTGGTTGTTGACT
TC
TTGCTGCCCACAGGGGTCTACTTGAACTTCCCCGTGTCCCGCAATGCCAACCTCAGCACCATCAAGCA
G
GTGCTGTGGCACCGTGCACAGTATGAGCCACTCTTCCACATGCTCAGTGACCCCGAGGCCTATGTGTTC
ACC
TGTGTGAACCAGACGGCGGAGCAGCAGGAGTTGGAGGATGAGCAGCGGAGGCTGTGCGACATCCAGC
CC
TTCCTGCCCGTGCTGCGCCTCGTGGCCCGAGAGGGGGACCGCGTGAAGAAGCTCATTAACTCCCAGAT
C
AGCCTCCTCATTGGCAAAGGTCTCCATGAGTTTGATTCCCTGCGGGACCCGGAAGTAAACGACTTCCGC
ACT
AAGATGCGCCAGTTTTGTGAAGAGGCTGCTGCTCACCGCCAGCAGCTGGGCTGGGTGGAATGGCTGC
AG
TACAGCTTCCCCCTGCAGCTGGAGCCCTCAGCAAGGGGTTGGCGGGCCGGCTTATTGCGTGTCAGCAA
C
CGAGCCCTGCTGGTCAACGTGAAGTTCGAGGGCAGTGAGGAGAGCTTCACCTTCCAGGTATCCACCAAG
GAC
ATGCCCCTGGCACTGATGGCCTGTGCCCTCCGAAAAAAGGCCACAGTGTTCCGGCAGCCTCTGGTGG
AG
CAGCCTGAGGAATATGCCCTGCAGGTGAACGGGAGGCACGAATACCTCTACGGCAACTACCCGCTCTG
C
CACTTTCAGTACATCTGCAGCTGCCTACACAGCGGGCTGACCCCTCATCTGACCATGGTCCACTCCTCC
TCC
ATCCTTGCTATGCGGGATGAGCAGAGCAATCCTGCCCCCCAAGTACAGAAACCACGTGCCAAACCTC
CC
CCGATCCCTGCCAAGAAGCCCTCCTCTGTGTCCCTGTGGTCCCTGGAACAGCCATTCTCCATTGAGCT
G
ATCGAGGGCCGAAAAGTGAATGCTGACGAGCGGATGAAGCTGGTTGTTCAGGCCGGGCTCTTCCATGGC
AAT
GAGATGCTGTGCAAGACTGTGTCAAGCTCGGAGGTGAATGTATGCTCAGAGCCCGTGTGGAAGCAGC
GA
CTGGAGTTCGATATCAGCGTCTGTGACCTCCCGCGCATGGCTCGACTCTGTTTTGCTCTCTATGCCGT
C
GTGGAGAAGGCTAAGAAGGCACGCTCCACAAAGAAGAAGTCTAAGAAGGCGGACTGCCCCATCGCTTGG
GCC
AACCTCATGCTATTCGACTACAAAGATCAGCTCAAGACGGGGGAGCGCTGCCTCTACATGTGGCCCT
CT
GTCCCAGATGAGAAGGGAGAGCTGCTGAATCCTGCGGGTACAGTGCGCGGGAACCCCAACACGGAGAG
T
GCCGCTGCCCTGGTCATCTACCTGCCTGAGGTGGCCCCCCACCCTGTGTACTTCCCCGCTCTGGAGAAG
ATC
CTGGAGCTGGGGCGTCACGGGGAGCGTGGGCGCATCACGGAGGAGGAGCAGCTGCAGCTGCGGGAGA
TC
CTGGAACGGCGGGGATCCGGGGAACTGTACGAACATGAGAAGGACCTGGTGTGGAAGATGCGCCACGA
A
GTCCAGGAGCATTTCCCAGAGGCGCTGGCCCGCCTGCTGCTGGTCACCAAGTGGAATAAACACGAGGAT
GTG
GCCCAGATGCTCTATTTGCTGTGCTCCTGGCCCGAGCTGCCTGTGCTGAGCGCCCTGGAACTTCTGG
AC
TTTAGCTTTCCCGACTGCTACGTGGGCTCCTTCGCCATCAAGTCCCTTCGGAAGCTGACGGACGATGA
G
CTCTTCCAGTACCTTCTGCAGCTGGTGCAAGTGCTCAAATATGAGTCCTACCTGGACTGCGAGCTGACC
AAA
TTCTTGCTGGGCCGAGCCCTGGCTAACCGCAAGATCGGACACTTCCTGTTCTGGCACCTCCGCTCTG
AG
ATGCACGTACCATCAGTGGCTCTGCGGTTTGGTCTCATCATGGAAGCCTACTGCAGAGGCAGCACCCA
C
CACATGAAGGTGCTGATGAAGCAGGGGGAAGCACTGAGCAAGCTTAAGGCACTGAATGACTTTGTGAAG
GTG
AGTTCCCAGAAGACCACCAAGCCCCAAACCAAGGAGATGATGCATATGTGCATGCGCCAGGAGACCT
AC
ATGGAGGCCCTGTCCCACCTGCAGTCTCCACTCGACCCCAGCACCCTGCTGGAGGAAGTCTGCAGTGT
G
GAGCAGTGCACCTTCATGGACTCCAAAATGAAGCCCCTGTGGATCATGTACAGCAGCGAGGAGGCGGGC
AGT
GCTGGCAACGTGGGCATCATCTTTAAGAACGGGGATGACCTCCGCCAGGACATGCTGACTCTGCAGA
TG
ATCCAGCTCATGGACGTCCTGTGGAAGCAGGAGGGCCTGGACCTGAGGATGACGCCCTACGGCTGCCT
C
CCCACCGGGGACCGCACAGGTCTCATCGAGGTGGTCCTCCACTCGGACACCATCGCCAACATCCAGCTG
AAC
AAAAGCAACATGGCGGCCACAGCTGCCTTCAACAAGGACGCCCTGCTCAACTGGCTCAAGTCCAAGA
AC
CCTGGGGAGGCCCTGGATCGGGCCATTGAGGAATTCACCCTCTCCTGTGCTGGCTACTGTGTGGCCAC
A
TATGTTCTGGGCATCGGTGACCGGCACAGCGACAACATCATGATCAGAGAGAGTGGGCAGCTCTTCCAC
ATT
GATTTTGGCCACTTTCTGGGGAACTTCAAGACCAAGTTTGGAATCAACCGAGAGCGCGTCCCCTTCA
TT
CTCACCTACGACTTTGTCCACGTGATCCAGCAGGGGAAGACTAACAACAGTGAGAAGTTTGAAAGGTT
C
CGCGGCTACTGTGAACGAGCCTATACCATCCTGCGGCGCCACGGGCTGCTTTTCCTCCATCTCTTCGCC
CTG
ATGCGGGCCGCAGGTCTGCCTGAGCTTAGCTGCTCCAAAGATATCCAGTATCTCAAGGACTCTCTGG
CA
CTGGGGAAGACGGAGGAAGAGGCGCTAAAGCACTTCCGGGTGAAGTTCAACGAAGCTCTCCGAGAAAG
C
TGGAAAACCAAAGTCAACTGGCTGGCGCACAATGTGTCCAAGGATAACCGACAGTAG


Translation (1045 aa):
MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFHMLSDPEAYVF
T
CVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLLIGK
GLHEFDSLRDPEVNDFR
T
KMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSE
ESFTFQVSTK
D
MPLALMACALRKKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQ
YICSCLHSGLTPHLTMVHSS
S
ILAMRDEQSNPAPQVQKPRAKPPPIPAKK
PSSVSLWSLEQPFSIELIEGRKVNADERMKLVVQAGLFHG
N
EMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSKKA
DCPIAW
A
NLMLFDYKDQLKTGERCLYMWPSVP
DEKGELLNPAGTVRGNPNTESAAALVIYLPEVAPHPVYFPALEK
I
LELGRHGERGRITEEE
QLQLREILERRGSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHED
V
AQ
MLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELT
K
FLLGRALANRKIGHFLFWHL
RSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVK
V
SSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEV
CSVEQCTFMDSKMKPLWIMYSSEEAG
S
AGNVGIIFKNGD
DLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQL
N
KSNMAATAAFNKDALLNWLKSKNP
GEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFH
I
DFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFE
RFRGYCERAYTILRRHGLLFLHLFA
L
MRAAGLPELSCSKDIQYLK
DSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser