NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS43451.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43451.1 Public Homo sapiens 6 HLA-DQB1 11 103 68 CCDS HistoryNCBI Gene:3119Re-query CCDS DB by CCDS ID:43451.1Re-query CCDS DB by GeneID:3119

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Sequence IDs included in CCDS 43451.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000399084 ENSP00000382034 Accepted alive Link to Ensembl Transcript Viewer:ENST00000399084Link to Ensembl Protein Viewer:ENSP00000382034Re-query CCDS DB by Nucleotide ID:ENST00000399084Re-query CCDS DB by Protein ID:ENSP00000382034
Original member Current member EBI,WTSI ENST00000434651 ENSP00000407332 Accepted alive Link to Ensembl Transcript Viewer:ENST00000434651Link to Ensembl Protein Viewer:ENSP00000407332Re-query CCDS DB by Nucleotide ID:ENST00000434651Re-query CCDS DB by Protein ID:ENSP00000407332
Original member Current member EBI,WTSI OTTHUMT00000276126 OTTHUMP00000178569 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000276126Link to Vega Protein Viewer:OTTHUMP00000178569Re-query CCDS DB by Nucleotide ID:OTTHUMT00000276126Re-query CCDS DB by Protein ID:OTTHUMP00000178569
Original member Current member EBI,WTSI OTTHUMT00000276127 OTTHUMP00000178570 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000276127Link to Vega Protein Viewer:OTTHUMP00000178570Re-query CCDS DB by Nucleotide ID:OTTHUMT00000276127Re-query CCDS DB by Protein ID:OTTHUMP00000178570
Original member Current member NCBI NM_002123.4 NP_002114.3 Accepted alive Link to Nucleotide Sequence:NM_002123.4Link to Protein Sequence:NP_002114.3Re-query CCDS DB by Nucleotide ID:NM_002123Re-query CCDS DB by Protein ID:NP_002114Link to BLink:NP_002114.3

Chromosomal Locations for CCDS 43451.1

Assembly GRCh37.p9 (GCF_000001405.21)

On '-' strand of Chromosome 6 (NC_000006.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 32628013 32628026 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32629124 32629234 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32629744 32630025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32632575 32632844 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32634276 32634384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (786 nt):
ATGTCTTGGAAGAAGGCTTTGCGGATCCCCGGAGACCTTCGGGTAGCAACTGTCACCTTGATGCTGGCGA
TG
CTGAGCTCCCTACTGGCTGAGGGCAGAGACTCTCCCGAGGATTTCGTGTTCCAGTTTAAGGGCATGTG
C
TACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATCTATAACCGAGAGGAGTACGCG
CGC
TTCGACAGCGACGTGGGGGTGTACCGCGCGGTGACGCCGCAGGGGCGGCCTGATGCCGAGTACTGGA
AC
AGCCAGAAGGAAGTCCTGGAGGGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGGT
G
GCGTTCCGCGGGATCTTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCC
CTC
AACCACCACAACCTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGGCCAGATCAAAGTCCGGTGGT
TT
CGGAATGATCAGGAGGAGACAGCCGGCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACTTT
C
CAGATCCTGGTGATGCTGGAAATGACTCCCCAGCGTGGAGATGTCTACACCTGCCACGTGGAGCACCCC
AGC
CTCCAGAGCCCCATCACCGTGGAGTGGCGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTG
GC
GTTGGAGGCTTCGTGCTGGGGCTGATCTTCCTTGGGCTGGGCCTTATCATCCGTCAAAGGAGTCAGAA
A
GGGCTTCTGCACTGA


Translation (261 aa):
MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYA
R
FDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRR
VEPTVTISPSRTEA
L
NHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHP
S
LQSPITVEW
RAQSESAQSKMLSGVGGFVLGLIFLGLGLIIRQRSQKGLLH



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser