NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS211.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
211.1 Public Homo sapiens 1 PINK1 11 103 68 CCDS HistoryNCBI Gene:65018Re-query CCDS DB by CCDS ID:211.1Re-query CCDS DB by GeneID:65018

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 211.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000321556 ENSP00000364204 Accepted alive Link to Ensembl Transcript Viewer:ENST00000321556Link to Ensembl Protein Viewer:ENSP00000364204Re-query CCDS DB by Nucleotide ID:ENST00000321556Re-query CCDS DB by Protein ID:ENSP00000364204
Original member Current member EBI,WTSI OTTHUMT00000007954 OTTHUMP00000002881 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000007954Link to Vega Protein Viewer:OTTHUMP00000002881Re-query CCDS DB by Nucleotide ID:OTTHUMT00000007954Re-query CCDS DB by Protein ID:OTTHUMP00000002881
Original member Current member NCBI NM_032409.2 NP_115785.1 Accepted alive Link to Nucleotide Sequence:NM_032409.2Link to Protein Sequence:NP_115785.1Re-query CCDS DB by Nucleotide ID:NM_032409Re-query CCDS DB by Protein ID:NP_115785Link to BLink:NP_115785.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_115785.1 581 Q9BXM7-1 581 100% 0 0

Chromosomal Locations for CCDS 211.1

Assembly GRCh37.p9 (GCF_000001405.21)

On '+' strand of Chromosome 1 (NC_000001.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 20960042 20960428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 20964335 20964622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 20966385 20966485 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 20970983 20971165 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 20972053 20972216 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 20974998 20975125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 20975488 20975724 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 20976927 20977184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1746 nt):
ATGGCGGTGCGACAGGCGCTGGGCCGCGGCCTGCAGCTGGGTCGAGCGCTGCTGCTGCGCTTCACGGGCA
AG
CCCGGCCGGGCCTACGGCTTGGGGCGGCCGGGCCCGGCGGCGGGCTGTGTCCGCGGGGAGCGTCCAGG
C
TGGGCCGCAGGACCGGGCGCGGAGCCTCGCAGGGTCGGGCTCGGGCTCCCTAACCGTCTCCGCTTCTTC
CGC
CAGTCGGTGGCCGGGCTGGCGGCGCGGTTGCAGCGGCAGTTCGTGGTGCGGGCCTGGGGCTGCGCGG
GC
CCTTGCGGCCGGGCAGTCTTTCTGGCCTTCGGGCTAGGGCTGGGCCTCATCGAGGAAAAACAGGCGGA
G
AGCCGGCGGGCGGTCTCGGCCTGTCAGGAGATCCAGGCAATTTTTACCCAGAAAAGCAAGCCGGGGCCT
GAC
CCGTTGGACACGAGACGCTTGCAGGGCTTTCGGCTGGAGGAGTATCTGATAGGGCAGTCCATTGGTA
AG
GGCTGCAGTGCTGCTGTGTATGAAGCCACCATGCCTACATTGCCCCAGAACCTGGAGGTGACAAAGAG
C
ACCGGGTTGCTTCCAGGGAGAGGCCCAGGTACCAGTGCACCAGGAGAAGGGCAGGAGCGAGCTCCGGGG
GCC
CCTGCCTTCCCCTTGGCCATCAAGATGATGTGGAACATCTCGGCAGGTTCCTCCAGCGAAGCCATCT
TG
AACACAATGAGCCAGGAGCTGGTCCCAGCGAGCCGAGTGGCCTTGGCTGGGGAGTATGGAGCAGTCAC
T
TACAGAAAATCCAAGAGAGGTCCCAAGCAACTAGCCCCTCACCCCAACATCATCCGGGTTCTCCGCGCC
TTC
ACCTCTTCCGTGCCGCTGCTGCCAGGGGCCCTGGTCGACTACCCTGATGTGCTGCCCTCACGCCTCC
AC
CCTGAAGGCCTGGGCCATGGCCGGACGCTGTTCCTCGTTATGAAGAACTATCCCTGTACCCTGCGCCA
G
TACCTTTGTGTGAACACACCCAGCCCCCGCCTCGCCGCCATGATGCTGCTGCAGCTGCTGGAAGGCGTG
GAC
CATCTGGTTCAACAGGGCATCGCGCACAGAGACCTGAAATCCGACAACATCCTTGTGGAGCTGGACC
CA
GACGGCTGCCCCTGGCTGGTGATCGCAGATTTTGGCTGCTGCCTGGCTGATGAGAGCATCGGCCTGCA
G
TTGCCCTTCAGCAGCTGGTACGTGGATCGGGGCGGAAACGGCTGTCTGATGGCCCCAGAGGTGTCCACG
GCC
CGTCCTGGCCCCAGGGCAGTGATTGACTACAGCAAGGCTGATGCCTGGGCAGTGGGAGCCATCGCCT
AT
GAAATCTTCGGGCTTGTCAATCCCTTCTACGGCCAGGGCAAGGCCCACCTTGAAAGCCGCAGCTACCA
A
GAGGCTCAGCTACCTGCACTGCCCGAGTCAGTGCCTCCAGACGTGAGACAGTTGGTGAGGGCACTGCTC
CAG
CGAGAGGCCAGCAAGAGACCATCTGCCCGAGTAGCCGCAAATGTGCTTCATCTAAGCCTCTGGGGTG
AA
CATATTCTAGCCCTGAAGAATCTGAAGTTAGACAAGATGGTTGGCTGGCTCCTCCAACAATCGGCCGC
C
ACTTTGTTGGCCAACAGGCTCACAGAGAAGTGTTGTGTGGAAACAAAAATGAAGATGCTCTTTCTGGCT
AAC
CTGGAGTGTGAAACGCTCTGCCAGGCAGCCCTCCTCCTCTGCTCATGGAGGGCAGCCCTGTGA


Translation (581 aa):
MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFF
R
QSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQ
AIFTQKSKPGP
D
PLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPG
A
PAFPLAIKMMWNIS
AGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRA
F
TSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMK
NYPCTLRQYLCVNTPSPRLAAMMLLQLLEGV
D
HLVQQGIAHRDLKSDNILVELDP
DGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVST
A
RPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALL
Q
REASK
RPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLA
N
LECETLCQAALLLCSWRAAL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser