NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39726.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39726.1 Public Mus musculus 7 Cacng6 10 38.1 68 CCDS HistoryNCBI Gene:54378Re-query CCDS DB by CCDS ID:39726.1Re-query CCDS DB by GeneID:54378

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 39726.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000108647 ENSMUSP00000104287 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108647Link to Ensembl Protein Viewer:ENSMUSP00000104287Re-query CCDS DB by Nucleotide ID:ENSMUST00000108647Re-query CCDS DB by Protein ID:ENSMUSP00000104287
Original member Current member NCBI NM_133183.1 NP_573446.1 Accepted alive Link to Nucleotide Sequence:NM_133183.1Link to Protein Sequence:NP_573446.1Re-query CCDS DB by Nucleotide ID:NM_133183Re-query CCDS DB by Protein ID:NP_573446Link to BLink:NP_573446.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_573446.1 260 Q8VHW3 260 100% 0 0

Chromosomal Locations for CCDS 39726.1

Assembly GRCm38 (GCF_000001635.20)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

Chromosome Start Stop Links
7 3424662 3424992 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 3430438 3430512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 3431819 3431956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 3434702 3434940 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (783 nt):
ATGATGTGGTCTAACTTCTTCATGCAAGAGGAAGACCGACGCCGGACAGCTGTGGGCCGGCGTCGTGCCC
AA
GAACAGCAGAATCTCGGCTTGACTCCGGAGCGAGAGGGCAAGATCAAGCTGGGGTTGCTGGTGGCAAT
C
GTGGGTGCTACGCTGGCTGTGCTGGCTGTGGGCACCGAGTTCTGGGTGGAACTCAATACATACAAGACC
AAT
GGCAGCGCCGTCTGTGAGGCCGCCCATTTGGGGCTGTGGAAGGTGTGCATCAAGCGACTGTGGCAGG
CG
GATGTGCCCGCGGGCAGGGAGACCTGTGGCCCAGCTGAGCTGCCAGGAGAAGCAAACTGCACCTACTT
C
AAATTCTTCACCACGGGGGAAAATGCGCGCATCTTCCAGCGAACCACCAAGAAAGAGGTAAACCTGGCA
GCT
GCCGTGATAGCTGTGCTGGGCCTGACGGCCATGGCCTTGGGCTGCCTCTGTGTCATCATGGTGCTCA
GT
AAAGGTGCAGAGTCCCTGCTCCGATTGGGAGCTGTCTGCTTTGGCCTCTCAGGCCTGCTGCTCTTTGT
C
AGCCTGGAGGTGTTCCGGCATTCCGTAGGAGCCCTGCTGCAGGGAGTCAACCCTGAGACCCCTCCAGCT
CCA
CGCCTGGCCTATGAGTATTCCTGGTCCTTAGGCTGTGGTGTGGGCGCTGGTCTAATCCTGCTGCTGG
GG
GGAGTCTGTTTCCTCCTGCTCACCTTGCCTTCCTGGCCCTGGAGGTCACTGTGCCCCAAGTGGGGTGG
C
CCAACCGCCTAG


Translation (260 aa):
MMWSNFFMQEEDRRRTAVGRRRAQEQQNLGLTPEREGKIKLGLLVAIVGATLAVLAVGTEFWVELNTYKT
N
GSAVCEAAHLGLWKVCIKRLWQADVPAGRETCGPAELPG
EANCTYFKFFTTGENARIFQRTTKKEVNLA
A
AVIAVLGLTAMALGCLCVIMVLSKGAESLLRLGAVCFGLS
GLLLFVSLEVFRHSVGALLQGVNPETPPA
P
RLAYEYSWSLGCGVGAGLILLLGGVCFLLLTLPSWPWRSLCPKWGGPTA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser