NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20664.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20664.1 Public Mus musculus 6 Ptpro 10 38.1 68 CCDS HistoryNCBI Gene:19277Re-query CCDS DB by CCDS ID:20664.1Re-query CCDS DB by GeneID:19277

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 20664.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000077115 ENSMUSP00000076364 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000077115Link to Ensembl Protein Viewer:ENSMUSP00000076364Re-query CCDS DB by Nucleotide ID:ENSMUST00000077115Re-query CCDS DB by Protein ID:ENSMUSP00000076364
Original member Current member NCBI NM_011216.3 NP_035346.3 Accepted alive Link to Nucleotide Sequence:NM_011216.3Link to Protein Sequence:NP_035346.3Re-query CCDS DB by Nucleotide ID:NM_011216Re-query CCDS DB by Protein ID:NP_035346Link to BLink:NP_035346.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035346.3 1226 E9Q612 1226 100% 0 0

Chromosomal Locations for CCDS 20664.1

Assembly GRCm38 (GCF_000001635.20)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

Chromosome Start Stop Links
6 137252686 137252760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137368073 137368346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137376977 137377135 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137378005 137378157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137380174 137380647 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137382569 137382730 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137386167 137386363 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137392686 137392806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137393518 137393711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137394796 137394907 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137399445 137399596 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137400627 137400747 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137410974 137411113 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137414218 137414350 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137416803 137416923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137418209 137418277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137420324 137420407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137426765 137426800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137430672 137430753 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137441053 137441143 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137442645 137442721 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137443518 137443652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137443895 137444017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137449871 137450025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137454585 137454720 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137461653 137461757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3681 nt):
ATGGGGCACCTGCCTAGGGGAACGCTCGGGGGCCGCCGCCTGCTACCTCTGCTCGGGCTCTTTGTGCTGC
TC
AAGATTGTTACGACGTTCCACGTGGCTGTGCAAGATGACAACAATATCGTTGTGTCTTTAGAAGCTTC
T
GATATAGTCAGCCCAGCATCTGTGTATGTTGTGAGGGTAGCTGGCGAATCAAAAAACTATTTCTTCGAA
TTT
GAGGAATTTAACAGCACATTGCCTCCTCCTGTGGTCTTTAAGGCCACATATCACGGTCTTTATTACA
TA
ATCACTCTGGTGGTAGTCAACGGGAATGTGGTCACCAAACCATCCAGATCAATCACCGTGTTGACAAA
A
CCCTTGCCTGTAACCAGTGTGTCTATCTATGACTATAAACCTTCTCCTGAGACAGGAGTCCTGTTTGAA
ATC
CATTATCCGGAAAAATACAATGTGTTCAGCAGAGTGAACATCAGCTACTGGGAAGGGAGGGACTTCA
GG
ACGATGCTGTACAAAGATTTCTTTAAGGGGAAAACGGTGTTTAATCACTGGCTACCAGGACTATGTTA
C
AGTAACATCACTTTCCAGCTGGTATCGGAGGCAACTTTTAATAAAAGTACCCTTGTGGAGTACAGTGGT
GTG
AGCCATGAACCCAAACAGCACAGAACAGCACCATATCCACCTCGAAACATCTCTGTTCGCTTTGTCA
AC
TTGAACAAGAACAACTGGGAGGAGCCGAGCGGGAGCTTCCCCGAGGACTCGTTCATCAAACCACCGCA
A
GATTCAATAGGAAGAGACAGACGCTTCCATTTCCCCGAAGAAACTCCGGAGACTCCCCCCAGCAATGTG
TCC
TCCGGTTCTCCCCCCAGCAATGTGTCCTCCGCTTGGCCTGACCCGAATAGCACAGACTATGAAAGCA
CA
TCACAGCCCTTCTGGTGGGACAGTGCATCCGCGGCCCCTGAAAACGAGGAGGACTTTGTCAGTGCGCT
G
CCAGCAGACTATGACACTGAGACCACACTCGATAGGACAGAGAAGCCCACAGCCGACCCTTTCTCTGCC
TTC
CCTGTGCAGATGACTCTGAGCTGGTTACCACCCAAACCGCCCACAGCCTTTGATGGCTTCAATATCC
TC
ATAGAGAGGGAAGAGAACTTTACTGACTATTTGACAGTGGATGAAGAAGCCCATGAATTCGTTGCAGA
A
CTGAAGGAGCCTGGGAAATACAAACTCTCAGTGACAACCTTTAGCTCCTCGGGGGCCTGTGAGACTCGG
AAA
AGCCAGTCAGCAAAATCGCTCAGCTTCTACATCAGCCCCACAGGCGAGTGGATTGAAGAACTGACCG
AG
AAACCTCAGCATGTGAGTGTCCACGTCTTAAGCTCAACCACCGCCTTGATGTCGTGGACATCTTCTCA
G
GAGAACTACAACAGCACCATTGTGTCTGTGGTGTCCTTGACCTGCCAGAAACAGAAGGAGAGCCAGCGG
CTG
GAGAAGCAGTATTGTACCCAGGTGAACTCAAGCAAACCTGTAATTGAGAACCTGGTTCCTGGTGCCC
AG
TACCAGGTTGTGATGTACTTAAGAAAAGGCCCTTTGATTGGGCCACCTTCCGATCCTGTGACATTTGC
G
ATTGTTCCCACTGGGATCAAAGATTTAATGCTCTACCCCTTGGGTCCCACTGCTGTCGTGCTGAGCTGG
ACC
CGACCTATCCTGGGAGTCTTCAGAAAATACGTGGTTGAAATGTTCTACTTCAACCCCACCACCATGA
CC
TCAGAGTGGACGACCTACTATGAGATAGCAGCCACAGTTTCCTTAACGGCATCCGTGAGAATAGCAAG
C
CTATTGCCAGCGTGGTACTACAACTTCCGCGTAACCATGGTGACATGGGGAGATCCAGAGCTGAGCTGT
TGT
GACAGTTCCACCATCAGCTTCATAACAGCCCCCGTTGCTCCAGAAATCACGTCTGTGGAGTACTTCA
AC
AGCCTGCTGTACATCAGTTGGACCTATGGGGATGCCACCACTGACCTGTCCCACTCTAGAATGCTGCA
C
TGGATGGTCGTTGCAGAAGGGAGGAAGAAAATTAAAAAGAGTGTGACACGCAATGTCATGACGGCCATC
CTT
AGCCTGCCTCCAGGAGATATCTACAATCTGTCTGTCACGGCCTGCACTGAGAGAGGGAGCAACACCT
CC
TTGCCCCGCCTTGTCAAGCTCGAACCAGCCCCTCCGAAGTCACTCTTCGCAGTGAACAAAACACAGAC
G
TCAGTGACCCTGCTGTGGGTTGAGGAGGGTGTTGCTGATTTCTTTGAAGTCTTCTGTCAGCAGCTCGGC
TCT
GGCCACAATGGCAAACTCCAGGAGCCAGTAGCTGTGTCGTCCCACGTGGTGACCATCTCCAGCCTCC
TC
CCAGCCACTGCCTACAACTGCAGTGTCACCAGCTTCAGCCACGACACTCCCAGTGTCCCTACATTCAT
A
GCTGTCTCCACAATGGTTACAGAGGTGAACCCTAACGTGGTGGTGATCTCGGTGCTGGCCATCCTCAGC
ACA
CTTTTAATTGGACTGCTCTTAGTGACCCTTGTCATTCTCCGAAAGAAGCACCTGCAGATGGCTAGGG
AA
TGTGGAGCTGGCACGTTTGTTAACTTTGCATCCTTAGAAAGGGAAGGGAAACTCCCCTACAGTTGGCG
T
AGGAGTGTGTTTGCTCTCTTAACCCTGCTGCCTTCATGTCTTTGGACTGACTATCTTTTGGCATTTTAT
ATT
AACCCTTGGAGTAAAAATGGCTTAAAGAAGAGGAAACTAACAAACCCCGTTCAGCTGGATGACTTCG
AT
TCTTACATCAAGGATATGGCCAAGGACTCGGACTATAAATTCTCTCTTCAGTTTGAGGAGTTGAAGTT
G
ATTGGACTGGATATTCCGCACTTTGCTGCAGATCTACCGCTGAACCGATGTAAAAACCGCTACACAAAC
ATC
CTGCCGTATGACTTTAGCCGGGTGAGGCTAGTCTCCATGAACGAAGAGGAAGGAGCAGACTACATTA
AT
GCCAACTATATTCCTGGATACAACTCACCCCAGGAGTACATTGCCACCCAGGGTCCCCTGCCAGAAAC
C
AGAAATGACTTCTGGAAGATGGTCCTACAACAGAAGTCCCACATCATCGTCATGCTCACTCAATGCAAT
GAG
AAAAGGAGGGTAAAATGTGACCACTACTGGCCATTCACAGAAGAACCCATTGCTTATGGGGACATCA
CC
GTGGAGATGGTCTCTGAGGAAGAGGAGGAGGACTGGGCCAGTAGACACTTCCGGATCAACTATGCGGA
C
GAAGCGCAGGACGTGATGCATTTTAACTACACAGCCTGGCCCGATCACGGCGTGCCTCCAGCAAACGCC
GCC
GAGAGCATCCTGCAGTTTGTGTTCACAGTGCGACAGCAAGCCGCCAAGAGCAAAGGGCCCATGATCA
TC
CACTGCAGTGCGGGTGTGGGACGGACAGGAACCTTCATTGCCCTGGACAGGCTCCTGCAACACATTCG
A
GATCATGAATTTGTGGACATCTTAGGGCTGGTATCAGAGATGCGCTCATACCGAATGTCAATGGTACAG
ACA
GAGGAGCAGTACATTTTTATCCATCAGTGTGTGCAGCTGATGTGGCTGAGGAAGAAGCAACAGTTCT
GC
ATCAGCGACGTCATCTACGAGAACGTCAGCAAATCCTAG


Translation (1226 aa):
MGHLPRGTLGGRRLLPLLGLFVLLKIVTTFHVAVQDDNNIVVSLEASDIVSPASVYVVRVAGESKNYFFE
F
EEFNSTLPPPVVFKATYHGLYYIITLVVVNGNVVTKPSRSITVLT
KPLPVTSVSIYDYKPSPETGVLFE
I
HYPEKYNVFSRVNISYWEGRDFRTMLYK
DFFKGKTVFNHWLPGLCYSNITFQLVSEATFNKSTLVEYSG
V
SHEPKQHRT
APYPPRNISVRFVNLNKNNWEEPSGSFPEDSFIKPPQDSIGRDRRFHFPEETPETPPSNV
S
SGSPPSNVSSAWPDPNSTDYESTSQPFWWDSASAAPENEEDFVSALPADYDTETTLDRTEKPTADPFSA
F
PVQMTLSWLPPKPPTAFDGFNILIERE
ENFTDYLTVDEEAHEFVAELKEPGKYKLSVTTFSSSGACETR
K
SQSAKSLSFYI
SPTGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQR
L
EKQYCTQ
VNSSKPVIENLVPGAQYQVVMYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSW
T
RPILGVFRKYVVEMFYFNPTTMTSEWTTYYEIAATVSLTASV
RIASLLPAWYYNFRVTMVTWGDPELSC
C
DSSTISFIT
APVAPEITSVEYFNSLLYISWTYGDATTDLSHSRMLHWMVVAEGRKKIKKSVTRNVMTAI
L
SLPPGDIYNLSVTACTERGSNTSLPRLVKL
EPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQLG
S
GHNGKLQ
EPVAVSSHVVTISSLLPATAYNCSVTSFSHDTPSVPTFIAVSTMVTEVNPNVVVISVLAILS
T
LLIGLLLVTLVILRKKHLQMA
RECGAGTFVNFASLEREGKLPYSWRRSVFALLTLLPSCLWTDYLLAFY
I
NP
WSKNGLKKRKLTNPVQLDDFDSYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTN
I
LP
YDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSHIIVMLTQCN
E
KRR
VKCDHYWPFTEEPIAYGDITVEMVSEEEEEDWASRHFRINYADEAQDVMHFNYTAWPDHGVPPANA
A
ESILQFVFTVRQQAAKSKGPMIIHC
SAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQ
T
E
EQYIFIHQCVQLMWLRKKQQFCISDVIYENVSKS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser