NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39318.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39318.1 Public Mus musculus 5 Por 10 38.1 68 CCDS HistoryNCBI Gene:18984Re-query CCDS DB by CCDS ID:39318.1Re-query CCDS DB by GeneID:18984

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 39318.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000005651 ENSMUSP00000005651 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000005651Link to Ensembl Protein Viewer:ENSMUSP00000005651Re-query CCDS DB by Nucleotide ID:ENSMUST00000005651Re-query CCDS DB by Protein ID:ENSMUSP00000005651
Original member Current member EBI,WTSI OTTMUST00000073476 OTTMUSP00000038028 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000073476Link to Vega Protein Viewer:OTTMUSP00000038028Re-query CCDS DB by Nucleotide ID:OTTMUST00000073476Re-query CCDS DB by Protein ID:OTTMUSP00000038028
Original member Current member NCBI NM_008898.1 NP_032924.1 Accepted alive Link to Nucleotide Sequence:NM_008898.1Link to Protein Sequence:NP_032924.1Re-query CCDS DB by Nucleotide ID:NM_008898Re-query CCDS DB by Protein ID:NP_032924Link to BLink:NP_032924.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032924.1 678 P37040 678 100% 0 0

Chromosomal Locations for CCDS 39318.1

Assembly GRCm38 (GCF_000001635.20)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

Chromosome Start Stop Links
5 135715885 135716063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135728662 135728710 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135729399 135729527 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135730229 135730378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135730844 135730968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135731093 135731182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135731563 135731661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135732483 135732599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135732686 135732804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135733502 135733683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135733773 135733922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135734027 135734297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135734383 135734528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135734621 135734706 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 135734813 135734957 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2037 nt):
ATGGGGGACTCTCACGAAGACACCAGTGCCACAGTGCCTGAGGCAGTGGCTGAAGAAGTGTCTCTATTCA
GC
ACAACGGACATTGTTCTGTTTTCTCTCATCGTGGGGGTCCTGACCTACTGGTTCATCTTTAAAAAGAA
G
AAAGAAGAGATACCGGAGTTCAGCAAGATCCAGACAACGGCCCCACCTGTCAAAGAGAGCAGCTTCGTG
GAA
AAGATGAAGAAAACGGGAAGGAACATTATTGTATTCTATGGCTCCCAGACGGGAACCGCGGAGGAGT
TT
GCCAACCGGCTGTCCAAGGATGCCCACCGCTATGGGATGCGGGGCATGTCTGCAGACCCTGAAGAGTA
T
GACTTGGCCGACCTGAGCAGCCTGCCTGAGATCGACAAGTCCCTGGTAGTCTTCTGCATGGCCACATAC
GGA
GAAGGCGACCCCACCGACAACGCGCAGGACTTCTATGATTGGCTGCAGGAGACTGACGTGGACCTCA
CG
GGTGTCAAGTTTGCTGTGTTTGGTCTCGGGAACAAGACCTATGAGCACTTCAACGCCATGGGCAAGTA
T
GTGGACCAGCGGCTGGAGCAGCTTGGCGCCCAGCGAATCTTTGAGTTGGGCCTTGGTGATGACGACGGG
AA
C
TTGGAAGAGGATTTCATCACATGGAGGGAGCAGTTCTGGCCAGCTGTGTGCGAGTTCTTCGGGGTGG
AA
GCCACTGGGGAGGAGTCGAGCATCCGCCAGTACGAGCTCGTGGTCCACGAAGACATGGACACAGCCAA
G
GTGTACACGGGTGAGATGGGCCGTCTGAAGAGCTACGAGAACCAGAAACCCCCCTTCGATGCCAAGAAT
CCA
TTCCTGGCTGCTGTCACCACGAACCGGAAGCTGAACCAAGGCACTGAGAGGCATCTAATGCACCTGG
AA
TTGGACATCTCAGACTCCAAGATCAGGTATGAATCTGGAGATCACGTGGCTGTGTACCCAGCCAACGA
C
TCCACCCTGGTCAACCAGATTGGGGAGATCCTGGGGGCTGACCTGGATGTCATCATGTCTCTAAACAAT
CTC
GATGAGGAGTCGAATAAGAAGCATCCGTTCCCCTGCCCCACCACCTACCGCACGGCCCTCACCTACT
AC
CTGGACATCACTAACCCGCCACGAACCAACGTGCTCTACGAGCTGGCCCAGTACGCCTCAGAGCCCTC
G
GAGCAGGAACACCTGCACAAGATGGCGTCCTCCTCCGGCGAGGGCAAGGAGCTGTACCTGAGCTGGGTG
GTG
GAGGCCCGGAGGCACATCCTAGCCATTCTCCAAGACTACCCGTCCCTGCGGCCACCCATCGACCACC
TG
TGCGAGCTCCTCCCGAGGCTGCAGGCCCGCTACTATTCCATTGCCTCGTCGTCTAAGGTCCACCCCAA
C
TCCGTGCACATCTGCGCCGTGGCTGTGGAGTATGAAGCGAAGTCTGGACGAGTGAACAAGGGGGTGGCC
ACC
AGCTGGCTTCGGACCAAGGAACCAGCAGGAGAGAATGGCCGCCGGGCCCTGGTCCCCATGTTCGTCC
GC
AAGTCCCAGTTCCGCTTGCCTTTCAAGCCCACCACACCTGTTATCATGGTGGGCCCCGGCACTGGGGT
T
GCCCCTTTCATGGGCTTCATCCAGGAGCGGGCTTGGCTTCGAGAGCAAGGCAAGGAGGTCGGAGAGACG
CTG
CTCTACTACGGCTGCCGGCGCTCGGATGAGGACTATCTGTACCGCGAGGAGCTGGCGCGCTTCCACA
AG
GACGGCGCCCTCACGCAGCTTAATGTGGCCTTTTCCCGTGAGCAGGCCCACAAGGTCTATGTTCAGCA
C
CTGCTCAAGAGGGACAAAGAGCACCTGTGGAAGCTGATCCACGAAGGTGGTGCCCACATCTATGTCTGC
GG
G
GATGCTCGAAATATGGCCAAAGATGTGCAGAACACATTCTATGACATCGTGGCCGAGTTTGGGCCCA
TG
GAGCACACCCAGGCTGTGGACTATGTTAAGAAGCTCATGACCAAGGGCCGCTACTCGCTGGATGTATG
G
AGCTAG


Translation (678 aa):
MGDSHEDTSATVPEAVAEEVSLFSTTDIVLFSLIVGVLTYWFIFKKKKEEIPEFSKIQTTAPPVKESSFV
E
KMKKT
GRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDKSLVVFCMATY
G
EGDPTDNAQDFYDWLQETDVDLTGVKFA
VFGLGNKTYEHFNAMGKYVDQRLEQLGAQRIFELGLGDDDG
N
LEEDFITWREQFWPAVCEFFGVEATGEESSIRQYELVVHEDMDTAKVYTGEMGRLKSYENQKPPFDAKN
P
FLAAVTTNRKLNQGTERHLMHLELDISDSKI
RYESGDHVAVYPANDSTLVNQIGEILGADLDVIMSLNN
L
D
EESNKKHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLHKMASSSGEGKELYLSWV
V
EARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSK
VHPNSVHICAVAVEYEAKSGRVNKGVA
T
SWLRTKEPAGENGRRALVPMFVRKSQFRLPFKPTTPVIMVGPGTGVAPFMGFIQERAWLREQ
GKEVGET
L
LYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQAHK
VYVQHLLKRDKEHLWKLIHEGGAHIYVC
G
DARNMAKDVQNTFYDIVAEFGPMEHTQAVDYVKKLMTKGRYSLDVWS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser