NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17098.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17098.1 Public Mus musculus 2 B4galt5 10 38.1 68 CCDS HistoryNCBI Gene:56336Re-query CCDS DB by CCDS ID:17098.1Re-query CCDS DB by GeneID:56336

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17098.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000109221 ENSMUSP00000104844 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109221Link to Ensembl Protein Viewer:ENSMUSP00000104844Re-query CCDS DB by Nucleotide ID:ENSMUST00000109221Re-query CCDS DB by Protein ID:ENSMUSP00000104844
Original member Current member EBI,WTSI OTTMUST00000002313 OTTMUSP00000001139 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000002313Link to Vega Protein Viewer:OTTMUSP00000001139Re-query CCDS DB by Nucleotide ID:OTTMUST00000002313Re-query CCDS DB by Protein ID:OTTMUSP00000001139
Original member Current member NCBI NM_019835.2 NP_062809.2 Accepted alive Link to Nucleotide Sequence:NM_019835.2Link to Protein Sequence:NP_062809.2Re-query CCDS DB by Nucleotide ID:NM_019835Re-query CCDS DB by Protein ID:NP_062809Link to BLink:NP_062809.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062809.2 388 Q9JMK0 388 100% 0 0

Chromosomal Locations for CCDS 17098.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 167301336 167301483 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 167302010 167302111 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 167304996 167305118 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 167305660 167305847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 167306591 167306707 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 167307544 167307668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 167309223 167309336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 167313087 167313221 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 167348918 167349032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1167 nt):
ATGCGCGCCCGCCGGGGGCTGCTGCGGCTGCCGCGCCGCTCGCTGCTCGCCGCGCTCTTCTTCTTCTCGC
TG
TCGTCCTCGCTGCTCTACTTCGTCTATGTGGCGCCCGGCATAGTGAACACCTACCTCTTCATGGTGCA
G
GCTCAGGGCATCCTACTGCGGGACAATGTGAGGACCATCGGTGCCCAGGTGTACGAGCAGGTGGTCCGC
AGC
GCCTATGCCAAGAGGAACAGCAGCCTGAATGACTCAGATTATCCTCTGGACTTGAACCACAGTGAAG
CC
TTTCCCCCAACCACGACCTTTCTTCCTGAAGATTTCACCTACTTTGCCAACCACCCTTGCCCAGAGAG
G
CTCCCTTCCATGAAGGGCCCGATAGATATAAACATGAGTGAGATCGCAATGGACGATATTCATGAGCTG
TTC
TCCAGAGACCCGGCCATTAAGCTCGGAGGGCACTGGAAGCCTGCAGACTGTGTGCCTCGGTGGAAGG
TG
GCTATCCTCATCCCCTTCCGGAACCGCCATGAGCACCTCCCGGTCCTCCTGAGACACCTGCTCCCCAT
G
CTTCAGCGCCAGCGCCTGCAGTTCGCCTTCTATGTGATCGAGCAAGTTGGCACCCAGCCCTTTAACCGA
GCC
ATGCTTTTCAATGTTGGTTTTCAAGAAGCCATGAAGGACTTGGATTGGGATTGTCTGATCTTCCATG
AC
GTCGATCACATACCTGAGAGTGACCGAAACTACTATGGCTGCGGGCAGATGCCCAGGCACTTTGCAAC
C
AAGCTGGACAAGTACATGTACCTGCTGCCCTACACTGAGTTTTTTGGTGGCGTGAGCGGCCTGACTGTA
GAA
CAGTTTCGGAAAATCAATGGCTTTCCTAATGCCTTCTGGGGCTGGGGCGGAGAAGATGACGACTTGT
GG
AACAGGGTACAAAATGCAGGCTATTCTGTGAGCCGGCCAGAAGGGGACACAGGAAAATACAAGTCCAT
T
CCTCACCACCATCGAGGAGAGGTCCAGTTTCTTGGCAGGTACGCTCTGCTGAGGAAGTCAAAGGAGCGG
CAA
GGACTGGATGGCCTCAACAACCTGAACTACTCTGCGAATGTCACGTACGACGCCTTGTATAAAAACA
TA
ACTGTCAACTTGACACCCGAGCTGGCTCAGGTGACTGAGTACTGA


Translation (388 aa):
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMVQAQGILLRDNVRTIGAQVYEQVVR
S
AYAKRNSSLNDS
DYPLDLNHSEAFPPTTTFLPEDFTYFANHPCPERLPSMKGPIDINMSEIAMDDIHEL
F
SRDPAIKLGGHWKPADCVPRWK
VAILIPFRNRHEHLPVLLRHLLPMLQRQRLQFAFYVIEQVGTQPFNR
A
MLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMY
LLPYTEFFGGVSGLTV
E
QFRKINGFPNAFWGWGGEDDDLWN
RVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKER
Q
GLDGLNNLNYSANVTYDALYKNITVNLTPELAQVTEY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser