NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28288.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28288.1 Public Mus musculus 16 Adamts5 10 38.1 68 CCDS HistoryNCBI Gene:23794Re-query CCDS DB by CCDS ID:28288.1Re-query CCDS DB by GeneID:23794

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28288.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023611 ENSMUSP00000023611 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023611Link to Ensembl Protein Viewer:ENSMUSP00000023611Re-query CCDS DB by Nucleotide ID:ENSMUST00000023611Re-query CCDS DB by Protein ID:ENSMUSP00000023611
Original member Current member NCBI NM_011782.2 NP_035912.2 Accepted alive Link to Nucleotide Sequence:NM_011782.2Link to Protein Sequence:NP_035912.2Re-query CCDS DB by Nucleotide ID:NM_011782Re-query CCDS DB by Protein ID:NP_035912Link to BLink:NP_035912.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035912.2 930 Q9R001 930 100% 0 0

Chromosomal Locations for CCDS 28288.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

Chromosome Start Stop Links
16 85862610 85863177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85866620 85866795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85868026 85868201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85868539 85868722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85869914 85870197 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85877870 85878037 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85887817 85887949 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85899164 85900267 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2793 nt):
ATGCGGCTCGAGTGGGCGCCCTTGTTGCTGCTACTGCTGCTGCTGAGCGCGTCCTGCCTGTCCCTGGCCG
CT
GACAGCCCCGCCGCGGCACCTGCCCAGGATAAAACCAGGCAGCCTCAGGCTGCAGCAGCGGCCGCCGA
G
CCGGACCAGCCGCAGGGGGAGGAAACACGGGAGCGAGGCCATTTACAACCCTTGGCCGGGCAGCGCAGG
AGC
GGCGGGCTGGTCCAGAATATAGACCAACTCTACTCTGGCGGTGGCAAAGTGGGCTACCTTGTCTACG
CG
GGCGGCCGGAGGTTCCTGCTGGACCTGGAGAGAGATGACACAGTGGGTGCTGCTGGTAGCATCGTTAC
T
GCAGGAGGAGGGCTGAGCGCATCCTCTGGCCACCGGGGTCACTGTTTCTACAGAGGCACCGTGGACGGC
AGC
CCTCGATCCCTAGCTGTCTTTGACCTCTGCGGGGGTCTCGATGGCTTCTTTGCAGTCAAGCATGCGC
GC
TACACTCTAAAGCCACTCCTGCGTGGGTCCTGGGCAGAGTATGAACGAATTTATGGGGATGGATCTTC
C
CGCATCCTGCATGTCTACAACCGCGAGGGCTTTAGCTTCGAGGCCCTGCCGCCACGCGCCAGTTGCGAG
ACT
CCTGCATCCCCATCTGGGCCCCAAGAGAGCCCCTCGGTGCACAGTAGATCTAGGAGACGCTCAGCGC
TG
GCCCCGCAGCTGCTGGACCACTCAGCTTTCTCGCCATCTGGGAACGCGGGACCTCAGACTTGGTGGAG
G
CGTAGGCGCCGTTCCATCTCCAGGGCCCGCCAGGTGGAGCTCCTCTTGGTGGCTGACTCGTCCATGGCC
AGG
ATGTATGGGCGGGGCCTGCAGCATTACCTGCTGACCCTGGCCTCCATCGCCAACAGGCTGTACAGTC
AT
GCAAGCATTGAGAACCACATCCGCCTGGCGGTGGTGAAGGTGGTGGTGCTGACGGACAAGGACACGAG
T
CTGGAGGTGAGCAAGAATGCGGCCACGACCCTCAAGAACTTTTGCAAATGGCAGCACCAACATAACCAG
CTA
GGGGATGATCACGAAGAGCACTACGATGCAGCCATCCTGTTCACCCGAGAGGATTTATGTGGGCATC
AT
TCATGTGACACCCTGGGAATGGCAGACGTTGGGACCATATGTTCTCCGGAGCGCAGCTGTGCAGTGAT
T
GAAGATGATGGCCTCCATGCAGCCTTCACTGTGGCTCATGAAATTGGGCATCTACTTGGCCTTTCTCAT
GAC
GATTCCAAATTCTGTGAAGAGAACTTCGGTACTACAGAAGACAAGCGTTTAATGTCTTCAATCCTTA
CC
AGCATCGATGCATCCAAGCCCTGGTCCAAATGCACGTCAGCCACCATCACAGAATTCCTGGATGATGG
T
CATGGTAATTGTTTGCTAGACCTACCACGGAAGCAGATTTTGGGTCCCGAGGAACTCCCAGGACAGACC
TAC
GATGCCACCCAGCAGTGCAACTTGACATTTGGGCCTGAGTACTCGGTGTGCCCTGGCATGGATGTCT
GT
GCGCGGCTGTGGTGTGCTGTGGTGCGCCAAGGCCAAATGGTGTGTCTGACCAAGAAGCTGCCGGCTGT
G
GAGGGCACTCCCTGTGGGAAGGGAAGAGTCTGCCTTCAAGGCAAATGTGTGGACAAAACTAAGAAAAAA
TAT
TACTCGACATCAAGCCATGGAAATTGGGGGTCCTGGGGCCCCTGGGGTCAGTGTTCTCGCTCATGCG
GG
GGAGGAGTGCAGTTTGCCTACCGCCATTGTAATAACCCTGCACCTCGAAACAGTGGCCGCTACTGCAC
A
GGGAAGAGGGCCATATACCGTTCCTGCAGTGTTACACCCTGCCCACCCAATGGTAAATCTTTTCGCCAT
GAG
CAGTGTGAAGCCAAAAATGGCTATCAGTCTGATGCAAAAGGAGTCAAAACATTTGTAGAATGGGTTC
CC
AAATATGCAGGTGTCCTGCCGGCAGATGTGTGCAAGCTTACCTGCAGAGCTAAGGGCACAGGCTACTA
T
GTGGTCTTTTCTCCAAAGGTTACGGATGGGACTGAATGCAGGCCGTACAGCAACTCTGTGTGTGTCCGA
GGA
CGGTGTGTGAGAACTGGATGTGACGGCATTATTGGCTCAAAGCTACAATATGACAAGTGTGGAGTGT
GC
GGAGGGGATAACTCCAGTTGTACAAAGATTATCGGAACCTTCAATAAAAAAAGCAAGGGTTATACTGA
C
GTTGTGAGGATCCCTGAAGGAGCAACCCACATAAAAGTCCGACAGTTCAAAGCCAAAGACCAGACTAGA
TTC
ACTGCCTACTTAGCCCTGAAGAAGAAAACTGGCGAGTACCTTATCAATGGCAAGTACATGATTTCCA
CT
TCAGAGACCATCATCGACATCAATGGTACCGTCATGAACTACAGTGGATGGAGCCACAGAGATGATTT
T
TTACATGGGATGGGCTATTCAGCCACAAAAGAAATCCTGATCGTGCAGATCCTTGCCACAGACCCAACT
AAA
GCGCTAGACGTCCGTTACAGCTTTTTTGTTCCCAAGAAGACCACTCAAAAAGTAAACTCTGTCATCA
GC
CATGGCAGCAACAAGGTGGGACCACACTCTACACAGCTGCAGTGGGTGACAGGTCCATGGCTGGCCTG
C
TCCAGGACCTGTGACACAGGCTGGCACACTAGGACCGTGCAGTGCCAGGATGGAAACAGGAAATTAGCT
AAA
GGATGCCTTCTCTCTCAGAGGCCTTCTGCATTTAAGCAATGTCTGCTGAAGAAATGTTAG


Translation (930 aa):
MRLEWAPLLLLLLLLSASCLSLAADSPAAAPAQDKTRQPQAAAAAAEPDQPQGEETRERGHLQPLAGQRR
S
GGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDDTVGAAGSIVTAGGGLSASSGHRGHCFYRGTVDG
S
PRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGSWAEYERIYGDGSSRILHVYNREGFSFEALPPRASCE
T
PASPSGPQESPSVHSRSRRRSALAPQLLDHSAFSPSGNAGPQTWWRRRRRSISRARQVELLLVADSSMA
R
MYGRGLQHYLLTLASIANRLYSHASIENHIRLAVVKVVVLTDKDTSLEVSKNAATTLKNFCKWQHQHNQ
L
GDDHEEHYDAAILFTRE
DLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH
D
DSKFCEENFGTTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGH
GNCLLDLPRKQILGPEELPGQT
Y
DATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRVCLQGKCVDKTKKK
Y
YS
TSSHGNWGSWGPWGQCSRSCGGGVQFAYRHCNNPAPRNSGRYCTGKRAIYRSCSVTPCPPNGKSFRH
E
QCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPK
VTDGTECRPYSNSVCVR
G
RCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKIIGTFNKK
SKGYTDVVRIPEGATHIKVRQFKAKDQTR
F
TAYLALKKKTGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT
K
ALDVRYSFFVPKKTTQKVNSVISHGSNKVGPHSTQLQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLA
K
GCLLSQRPSAFKQCLLKKC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser