NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27811.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27811.1 Public Mus musculus 15 Lmbr1l 10 38.1 68 CCDS HistoryNCBI Gene:74775Re-query CCDS DB by CCDS ID:27811.1Re-query CCDS DB by GeneID:74775

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27811.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023736 ENSMUSP00000023736 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023736Link to Ensembl Protein Viewer:ENSMUSP00000023736Re-query CCDS DB by Nucleotide ID:ENSMUST00000023736Re-query CCDS DB by Protein ID:ENSMUSP00000023736
Original member Current member EBI,WTSI OTTMUST00000058993 OTTMUSP00000028660 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000058993Link to Vega Protein Viewer:OTTMUSP00000028660Re-query CCDS DB by Nucleotide ID:OTTMUST00000058993Re-query CCDS DB by Protein ID:OTTMUSP00000028660
Original member Current member NCBI NM_029098.3 NP_083374.1 Accepted alive Link to Nucleotide Sequence:NM_029098.3Link to Protein Sequence:NP_083374.1Re-query CCDS DB by Nucleotide ID:NM_029098Re-query CCDS DB by Protein ID:NP_083374Link to BLink:NP_083374.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083374.1 489 Q9D1E5-1 489 100% 0 0

Chromosomal Locations for CCDS 27811.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

Chromosome Start Stop Links
15 98904441 98904508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98904665 98904826 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98905916 98905982 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98906244 98906334 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98907537 98907610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98907894 98907971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98908520 98908596 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98908676 98908759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98908849 98908921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98909203 98909267 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98909388 98909456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98911496 98911622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98912144 98912247 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98912398 98912537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98913557 98913590 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98915137 98915221 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98917850 98917921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1470 nt):
ATGGAAGCAGCTGACTACGAAGTGCTATCCGTGCGAGAACAGCTGTTCCACGACAGGGTCCGCGAGTGCA
TC
ATCTCAATACTTCTGTTTGCAACACTCTACATCCTCTGCCATATCTTCCTGACCCGCTTCAAGAAGCC
T
GCTGAGTTCACCACAGTGGATGATGAAGATGCCACAGTTAACAAGATTGCGCTGGAGCTGTGCACCTTT
ACC
CTGGCGGTCGCCCTGGGCGCCGTCTTACTCCTGCCCTTCTCCATCATCAGCAACGAGGTGCTGCTCT
CG
TTGCCACGCAACTACTACATCCAGTGGCTCAATGGCTCCCTCATCCATGGTCTGTGGAACCTCGTTTT
C
CTCTTCTCCAATCTGTCCCTCGTCTTCCTTATGCCCTTTGCATATTTCTTCACAGAGTCTGAAGGCTTT
GCT
GGCTCCAGAAAGGGTGTCCTGGGCCGGGTCTACGAGACAGTGGTGATGTTGATCCTCCTCACGCTGC
TT
GTGCTGGGCATGGTGTGGGTGGCATCCGCCATTGTAGACAATGACAAGGCCAGCAGGGAGTCGCTCTA
C
GACTTCTGGGAGTACTACCTCCCCTATCTCTACTCCTGTATCTCCTTCCTCGGAGTTCTGCTGCTTCTG
G
TG
TGCACTCCACTAGGTCTCGCCCGCATGTTCTCTGTCACTGGGAAGTTGCTGGTCAAGCCCCGGCTAC
TG
GAAGACCTGGAGGAACAGCTGAACTGCTCAGCCTTTGAGGAGGCAGCTCTGACTCGAAGAATCTGCAA
T
CCCACCTCCTGCTGGCTGCCACTGGACATGGAACTGCTGCATAGACAGGTCCTGGCTCTGCAGGCACAG
AGG
GTCCTCTTGGAAAAGCGTCGGAAGGCGTCAGCCTGGCAACGGAACCTGGGCTACCCTCTGGCCATGC
TG
TGCTTGCTGGTGCTGACGGGCCTGTCTGTCCTCATCGTGGCTGTCCACATCCTGGAGCTGCTTATTGA
C
GAGGCTGCCATGCCACGGGGCATGCAGGATGCTGCCCTAGGCCAGGCCTCCTTCTCCAAACTGGGATCC
TTT
GGCGCCATCATCCAGGTTGTGCTGATATTTTACCTGATGGTGTCCTCAGTGGTGGGTTTCTACAGCT
CT
CCACTCTTTGGAAGCCTGAGGCCTAGGTGGCATGACACATCGATGACACAGATCATTGGGAACTGTGT
C
TGCCTCCTGGTCCTCAGCTCAGCACTTCCTGTCTTCTCTAGAACTCTTGGCCTGACACGCTTTGACCTG
CTG
GGTGACTTTGGACGCTTCAACTGGCTAGGCAATTTCTACATCGTGTTCCTCTACAACGCAGCCTTTG
CT
GGCCTCACCACACTCTGTCTGGTGAAGACCTTCACGGCAGCTGTGAGGGCAGAGCTGATCCGAGCCTT
T
GGGCTGGACAGACTGCCACTGCCTGTCTCTGGGTTTCCCCGGGCTTCTAGGAAGAAGCAGCATCAATGA


Translation (489 aa):
MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFKKPAEFTTVDDEDATVNKIALELCTF
T
LAVALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIH
GLWNLVFLFSNLSLVFLMPFAYFFTESEGF
A
GSRK
GVLGRVYETVVMLILLTLLVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLL
V
CTPLGLARMFSVTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQ
R
VLL
EKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAALGQASFSKLGS
F
GAIIQVVLI
FYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDL
L
GDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAF
GLDRLPLPVSGFPRASRKKQHQ



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser