NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24820.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24820.1 Public Mus musculus 11 Ulk2 10 38.1 68 CCDS HistoryNCBI Gene:29869Re-query CCDS DB by CCDS ID:24820.1Re-query CCDS DB by GeneID:29869

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24820.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000004920 ENSMUSP00000004920 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000004920Link to Ensembl Protein Viewer:ENSMUSP00000004920Re-query CCDS DB by Nucleotide ID:ENSMUST00000004920Re-query CCDS DB by Protein ID:ENSMUSP00000004920
Original member Current member EBI,WTSI OTTMUST00000013001 OTTMUSP00000006044 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000013001Link to Vega Protein Viewer:OTTMUSP00000006044Re-query CCDS DB by Nucleotide ID:OTTMUST00000013001Re-query CCDS DB by Protein ID:OTTMUSP00000006044
Original member Current member NCBI NM_013881.4 NP_038909.3 Accepted alive Link to Nucleotide Sequence:NM_013881.4Link to Protein Sequence:NP_038909.3Re-query CCDS DB by Nucleotide ID:NM_013881Re-query CCDS DB by Protein ID:NP_038909Link to BLink:NP_038909.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038909.3 1037 Q9QY01 1037 100% 0 0

Chromosomal Locations for CCDS 24820.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 61777781 61777839 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61779674 61779809 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61781592 61781749 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61782006 61782124 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61783537 61783715 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61787429 61787637 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61791434 61791583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61799063 61799166 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61799460 61799650 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61799902 61800188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61801483 61801563 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61803642 61803787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61808062 61808199 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61812718 61812778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61819285 61819456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61824639 61824727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61825842 61825889 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61827602 61827684 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61829392 61829450 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61830590 61830691 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61833413 61833486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61834780 61834953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61840110 61840146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61841299 61841331 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61851062 61851103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61853266 61853358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 61854487 61854576 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3114 nt):
ATGGAGGTGGTGGGCGACTTCGAGTACTGCAAGCGGGACCTCGTGGGACACGGGGCCTTCGCTGTGGTCT
TC
CGGGGGCGGCACCGCCAGAAAACTGATTGGGAGGTGGCTATTAAAAGTATTAATAAAAAGAACTTGTC
A
AAATCACAAATTCTGCTTGGAAAGGAAATAAAAATCTTAAAGGAGCTTCAGCATGAAAACATCGTAGCG
CTC
TATGATGTTCAGGAATTGCCCAACTCTGTCTTTCTGGTGATGGAGTATTGCAATGGTGGAGACCTGG
CA
GATTATTTGCAAGCTAAAGGAACTCTGAGTGAAGATACTATCAGAGTGTTTCTCCATCAGATTGCGGC
A
GCCATGCGAATCCTGCACAGCAAAGGGATAATCCACAGGGATCTCAAACCACAGAATATCCTGTTGTCT
TAT
GCCAATCGAAGGAAGTCGAATGTCAGTGGTATTCGTATTAAAATAGCTGATTTTGGTTTCGCACGGT
AC
CTACATAGTAACACAATGGCAGCGACACTGTGTGGATCCCCAATGTACATGGCTCCCGAGGTTATTAT
G
TCTCAACATTATGATGCTAAGGCAGATTTATGGAGCATAGGAACAGTGATCTATCAATGCCTAGTTGGA
AAA
CCACCTTTTCAGGCTAATAGTCCTCAGGACCTAAGGATGTTTTATGAAAAAAACAGGAGCTTAATGC
CT
AGTATTCCCAGAGAAACATCACCTTACTTGGCTAATCTCCTTTTGGGTTTGCTTCAGAGAAATCAAAA
G
GATAGAATGGACTTTGAAGCATTTTTCAGCCATCCTTTCCTTGAGCAAGTTCCAGTTAAAAAATCTTGC
CCA
GTCCCAGTGCCTGTGTATTCTGGCCCTGTCCCTGGAAGCTCCTGCAGCAGCTCACCATCTTGTCGCT
TT
GCTTCTCCACCATCCCTTCCAGATATGCAGCATATTCAGGAAGAAAACTTATCCTCCCCACCGTTGGG
T
CCTCCCAACTATCTACAGGTGTCCAAAGACTCTGCGAGTAATAGTAGCAAGAACTCTTCTTGTGACACG
GAT
GACTTTGTTTTGGTTCCACACAACATCTCGTCAGACCACTCATATGACATGCCAATGGGGACTACGG
CC
AGACGTGCTTCAAATGAATTCTTTATGTGTGGAGGGCAGTGTCAACCTACTGTGTCACCTCACAGCGA
A
ACAGCCCCAATTCCAGTTCCTACTCAAGTAAGGAATTATCAGCGCATAGAACAGAATCTTATATCCACT
GCC
AGCTCTGGCACAAACCCACATGGTTCTCCAAGATCTGCAGTAGTACGAAGGTCTAATACCAGCCCCA
TG
GGCTTCCTCCGGGTTGGGTCCTGCTCCCCTGTACCAGGAGACACAGTGCAGACAGGAGGACGAAGACT
C
TCTACTGGCTCTTCCAGGCCTTACTCACCATCCCCTTTGGTTGGTACCATTCCTGAACAGTTTAGTCAG
TGC
TGCTGTGGACATCCTCAGGGCCATGAAGCCAGGAGTAGGCACTCCTCAGGTTCTCCAGTGCCACAGA
CC
CAGGCACCACAGTCACTCTTACTGGGTGCTAGACTGCAGAGTGCACCCACCCTCACCGATATCTATCA
G
AACAAGCAGAAGCTCAGAAAGCAGCACTCTGACCCTGTGTGTCCGTCCCATGCTGGAGCTGGGTATAGT
TAC
TCACCTCAGCCTAGTCGGCCTGGCAGCCTTGGGACCTCTCCCACCAAGCACACGGGGTCCTCTCCAC
GG
AATTCTGACTGGTTCTTTAAAACTCCTTTACCAACAATCATTGGCTCTCCTACTAAGACTACAGCTCC
T
TTCAAAATCCCTAAAACACAAGCATCTTCTAACCTGTTAGCCTTGGTTACTCGTCATGGGCCTGCTGAA
AGC
CAGTCCAAAGATGGGAATGACCCTCGTGAGTGTTCCCACTGCCTCTCAGTACAAGGAAGCGAGAGGC
AT
CGATCTGAGCAGCAGCAGAGCAAGGCAGTGTTTGGCAGATCTGTCAGTACTGGGAAGTTATCAGAACA
A
CAAGTAAAGGCACCTTTAGGTGGACACCAGGGCAGCACGGATAGTTTAAACACAGAACGACCAATGGAT
GTA
GCTCCTGCAGGAGCCTGTGGTGTTATGCTGGCATTGCCAGCAGGAACAGCAGCAAGCGCCAGAGCTG
TC
CTCTTCACCGTGGGGTCTCCTCCACACAGTGCCACAGCCCCCACTTGTACTCATATGGTCCTTCGAAC
A
AGAACCACCTCAGTGGGGTCCAGCAGCTCAGGAGGTTCCTTGTGTTCTGCAAGTGGCCGAGTATGTGTG
GGC
TCCCCTCCTGGACCAGGGTTGGGCTCTTCCCCACCAGGAGCAGAGGGAGCTCCCAGCCTAAGATACG
TG
CCTTATGGTGCTTCACCACCCAGCCTAGAGGGTCTCATCACCTTTGAAGCCCCTGAACTACCAGAGGA
G
ACACTGATGGAGCGAGAGCACACAGACACCTTACGCCATCTGAACATGATGTTAATGTTTACTGAGTGT
GTG
CTGGACCTGACGGCAGTGAGGGGTGGGAACCCTGAGCTGTGCACATCTGCTGTGTCCTTGTACCAGA
TT
CAGGAGAGTGTAGTTGTGGACCAGATCAGCCAGCTAAGCAAAGATTGGGGGCGGGTGGAGCAGCTGGT
G
TTGTACATGAAGGCAGCACAGCTGCTGGCGGCTTCCCTGCATCTCGCCAAAGCTCAGGTCAAGTCTGGG
AAG
CTGAGCCCATCCATGGCTGTGAAACAAGTTGTTAAAAATCTGAATGAAAGATACAAATTCTGCATCA
CC
ATGTGCAAGAAACTTACAGAAAAGCTGAATCGCTTCTTCTCCGATAAACAGAGATTTATTGATGAAAT
C
AACAGTGTGACTGCAGAGAAACTCATCTATAATTGTGCTGTGGAAATGGTTCAATCTGCAGCCCTGGAT
GAG
ATGTTTCAGCAGACTGAAGACATCGTTTATCGCTACCACAAGGCAGCCCTTCTTTTGGAAGGCTTAA
GT
AAGATCCTGCAGGACCCTACAGATGTTGAAAATGTGCATAAGTATAAATGTAGTATTGAAAGAAGATT
G
TCAGCACTCTGCTGTAGCACTGCAACTGTGTGA


Translation (1037 aa):
MEVVGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVA
L
YDVQ
ELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLS
Y
ANRRKSNVSGIRIKI
ADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVG
K
PPFQ
ANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVKKSC
P
VPVPVYSGPVPGSSCSSSPSCRFASPP
SLPDMQHIQEENLSSPPLGPPNYLQVSKDSASNSSKNSSCDT
D
DFVLVPHNISSDHS
YDMPMGTTARRASNEFFMCGGQCQPTVSPHSETAPIPVPTQVRNYQRIEQNLIST
A
SSGTNPHGSP
RSAVVRRSNTSPMGFLRVGSCSPVPGDTVQTGGRRLSTGSSRPYSPSPLVGTIPEQFSQ
C
CCGHPQGHEARSRHSS
GSPVPQTQAPQSLLLGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHAGAGYS
Y
SPQPSRPGSLGTSPTKHTGSSPRNSDWFFKTPLPTIIGSPTK
TTAPFKIPKTQASSNLLALVTRHGPAE
S
QSKDGNDPRECSHCLSVQGSERHRSEQQQSKAVFG
RSVSTGKLSEQQVKAPLGGHQGSTDSLNTERPMD
V
APAGACGVMLALPAGTAASARAVLFTVGSPPHSATAPTCTHMVLRTRTTSVGSSSSGGSLCSASGRVCV
G
SPPGPGLGSSPPGAEGAPSLRYVPYGASPPSLEGLITFEAPELPEETLME
REHTDTLRHLNMMLMFTEC
V
LDLTAVRGGNPELCTSAVSLYQIQESVVVDQISQLSKDW
GRVEQLVLYMKAAQLLAASLHLAKAQVKSG
K
LSPSMAVKQ
VVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQSAALD
E
MFQQTEDIVYRYHKAALLLEGLSKILQDPTDVENVHK
YKCSIERRLSALCCSTATV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser