NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48499.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48499.1 Public Mus musculus 10 Grm1 10 38.1 68 CCDS HistoryNCBI Gene:14816Re-query CCDS DB by CCDS ID:48499.1Re-query CCDS DB by GeneID:14816

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48499.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000105560 ENSMUSP00000101189 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105560Link to Ensembl Protein Viewer:ENSMUSP00000101189Re-query CCDS DB by Nucleotide ID:ENSMUST00000105560Re-query CCDS DB by Protein ID:ENSMUSP00000101189
Original member Current member EBI,WTSI ENSMUST00000105561 ENSMUSP00000101190 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105561Link to Ensembl Protein Viewer:ENSMUSP00000101190Re-query CCDS DB by Nucleotide ID:ENSMUST00000105561Re-query CCDS DB by Protein ID:ENSMUSP00000101190
Original member Current member EBI,WTSI OTTMUST00000039038 OTTMUSP00000017440 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039038Link to Vega Protein Viewer:OTTMUSP00000017440Re-query CCDS DB by Nucleotide ID:OTTMUST00000039038Re-query CCDS DB by Protein ID:OTTMUSP00000017440
Original member Current member EBI,WTSI OTTMUST00000041159 OTTMUSP00000018439 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041159Link to Vega Protein Viewer:OTTMUSP00000018439Re-query CCDS DB by Nucleotide ID:OTTMUST00000041159Re-query CCDS DB by Protein ID:OTTMUSP00000018439
Original member Current member NCBI NM_001114333.2 NP_001107805.1 Accepted alive Link to Nucleotide Sequence:NM_001114333.2Link to Protein Sequence:NP_001107805.1Re-query CCDS DB by Nucleotide ID:NM_001114333Re-query CCDS DB by Protein ID:NP_001107805Link to BLink:NP_001107805.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001107805.1 906 P97772-2 906 100% 0 0

Chromosomal Locations for CCDS 48499.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

Chromosome Start Stop Links
10 10698072 10698132 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10719223 10720153 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10733159 10733285 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10741436 10741604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10746545 10746791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10782559 10782794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10936329 10936578 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 11079839 11080538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2721 nt):
ATGGTCCGGCTCCTCTTGATTTTCTTCCCAATGATCTTTTTGGAGATGTCCATTTTGCCCAGGATGCCTG
AC
AGAAAAGTACTGCTGGCAGGTGCCTCGTCCCAGCGCTCTGTGGCGAGAATGGACGGAGATGTCATCAT
C
GGAGCCCTCTTCTCAGTCCATCACCAGCCTCCAGCCGAAAAGGTACCGGAAAGGAAGTGTGGGGAGATC
AGA
GAACAGTATGGTATCCAGAGAGTGGAGGCCATGTTCCACACATTAGATAAGATTAATGCGGACCCGG
TG
CTCCTGCCCAACATCACTCTGGGCAGTGAGATCCGGGACTCCTGCTGGCACTCTTCTGTGGCTCTGGA
A
CAGAGCATTGAGTTCATCAGAGACTCCCTGATTTCCATCCGAGATGAGAAGGATGGACTGAACCGCTGC
CTG
CCTGATGGCCAGACCCTACCCCCAGGCAGGACTAAGAAGCCTATTGCTGGAGTGATCGGCCCTGGCT
CC
AGCTCTGTGGCCATTCAAGTCCAGAATCTTCTGCAGCTGTTCGACATCCCACAAATCGCCTATTCTGC
C
ACGAGCATAGACCTGAGCGACAAAACTTTGTACAAATACTTCCTGAGGGTGGTCCCTTCTGACACTTTG
CAG
GCAAGGGCGATGCTTGATATCGTCAAGCGGTACAACTGGACCTATGTCTCTGCAGTCCACACAGAAG
GG
AATTACGGCGAGAGTGGAATGGATGCTTTCAAAGAGTTGGCTGCCCAGGAAGGACTCTGCATCGCACA
C
TCGGACAAAATCTACAGCAATGCTGGCGAGAAGAGCTTTGATCGGCTTCTGCGCAAGCTCCGAGAGCGG
CTT
CCCAAGGCCAGGGTTGTGGTCTGCTTCTGCGAGGGCATGACAGTGCGGGGGTTACTGAGTGCCATGC
GC
CGCCTTGGCGTCGTGGGAGAGTTCTCACTCATTGGAAGTGATGGATGGGCAGACAGAGATGAAGTCAT
C
GAAGGCTATGAGGTGGAAGCCAATGGGGGAATCACAATAAAGCTGCAGTCTCCAGAGGTCAGGTCGTTT
GAT
GACTACTTTCTGAAGCTGAGGCTGGACACCAACACGAGGAATCCTTGGTTCCCTGAGTTCTGGCAAC
AT
CGCTTCCAGTGTCGCCTACCTGGACACCTCTTGGAAAACCCCAACTTTAAAAAAGTCTGCACAGGAAA
T
GAAAGCTTGGAAGAAAATTATGTCCAGGACAGCAAAATGGGATTTGTCATCAACGCCATCTATGCCATG
GCA
CACGGCCTACAGAACATGCACCATGCTCTATGTCCTGGCTACGTGGGCCTTTGTGATGCCATGAAGC
CC
ATTGACGGCAGGAAGCTCCTGGATTTCCTCATCAAATCCTCTTTTGTTGGAGTGTCTGGAGAGGAGGT
C
TGGTTCGATGAGAAGGGGGATGCACCTGGAAGGTATGACATTATGAATCTGCAGTACACAGAGGCTAAT
CGC
TATGACTATGTCCATGTGGGAACCTGGCATGAAGGTGTGCTGAATATCGATGATTACAAAATCCAGA
TG
AACAAAAGCGGAATGGTACGATCTGTGTGCAGCGAGCCTTGCTTAAAGGGTCAGATTAAGGTCATACG
G
AAAGGGGAAGTGAGCTGCTGCTGGATCTGCACAGCCTGCAAAGAGAATGAGTTTGTGCAAGATGAGTTT
ACC
TGCAGAGCCTGTGACCTGGGGTGGTGGCCCAATGCAGAGCTCACAGGCTGTGAGCCCATTACTATCC
GT
TACCTCGAGTGGAGTGACATAGAATCCATCATAGCCATCGCCTTTTCTTGCCTGGGCATCCTCGTGAC
G
CTATTTGTCACCCTCATCTTTGTGCTGTACCGGGACACACCTGTGGTCAAATCCTCCAGTAGAGAGCTC
TGC
TATATCATTCTGGCTGGTATTTTCCTCGGCTACGTATGCCCTTTCACCCTCATCGCCAAACCTACTA
CC
ACATCCTGCTACCTCCAGCGCCTCCTAGTTGGCCTCTCTTCTGCCATGTGCTACTCTGCTCTTGTGAC
C
AAAACCAATCGTATTGCACGCATCCTGGCTGGCAGCAAGAAGAAGATCTGTACCCGGAAGCCCAGGTTC
ATG
AGCGCTTGGGCCCAAGTGATCATAGCCTCCATTCTGATTAGTGTACAGCTGACACTAGTGGTGACCT
TG
ATCATCATGGAGCCTCCCATGCCCATTTTGTCCTACCCGAGCATCAAGGAAGTCTATCTTATCTGCAA
T
ACCAGCAACCTGGGTGTAGTGGCACCTGTGGGTTACAACGGACTTCTCATCATGAGCTGTACCTACTAT
GCC
TTCAAGACCCGCAACGTGCCGGCCAATTTCAATGAGGCTAAATACATCGCCTTCACTATGTACACCA
CC
TGCATCATCTGGCTGGCTTTTGTTCCCATTTACTTTGGGAGCAACTACAAGATTATCACTACCTGCTT
C
GCAGTGAGCCTCAGTGTGACGGTGGCCCTGGGCTGCATGTTCACTCCCAAGATGTACATCATTATTGCC
AAA
CCCGAGAGGAATGTCCGCAGTGCCTTCACCACCTCTGATGTAGTGCGCATGCACGTCGGTGACGGCA
AG
CTGCCATGCCGCTCCAACACCTTCCTCAACATTTTCCGGAGAAAGAAGCCTGGGGCAGGGAACGCCAA
G
AAGAGGCAGCCAGAATTCTCGCCCAGCAGCCAGTGTCCGTCGGCACATGTGCAGCTTTGA


Translation (906 aa):
MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEI
R
EQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRC
L
PDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTL
Q
ARAMLDIVKRYNWTYVSAVHTE
GNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRER
L
PKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIG
SDGWADRDEVIEGYEVEANGGITIKLQSPEVRSF
D
DYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCT
GNESLEENYVQDSKMGFVINAIYAM
A
HGLQNMHHALCPGYVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPG
RYDIMNLQYTEAN
R
YDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIK
VIRKGEVSCCWICTACKENEFVQDEF
T
CRACDLGWWPNAELT
GCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSREL
C
YIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRF
M
SAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYY
A
FKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
K
PERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNA
KKRQPEFSPSSQCPSAHVQL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser