NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15041.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15041.1 Public Mus musculus 1 Cxcr1 10 38.1 68 CCDS HistoryNCBI Gene:227288Re-query CCDS DB by CCDS ID:15041.1Re-query CCDS DB by GeneID:227288

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15041.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000053389 ENSMUSP00000049714 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000053389Link to Ensembl Protein Viewer:ENSMUSP00000049714Re-query CCDS DB by Nucleotide ID:ENSMUST00000053389Re-query CCDS DB by Protein ID:ENSMUSP00000049714
Original member Current member EBI,WTSI OTTMUST00000051104 OTTMUSP00000024004 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051104Link to Vega Protein Viewer:OTTMUSP00000024004Re-query CCDS DB by Nucleotide ID:OTTMUST00000051104Re-query CCDS DB by Protein ID:OTTMUSP00000024004
Original member Current member NCBI NM_178241.4 NP_839972.1 Accepted alive Link to Nucleotide Sequence:NM_178241.4Link to Protein Sequence:NP_839972.1Re-query CCDS DB by Nucleotide ID:NM_178241Re-query CCDS DB by Protein ID:NP_839972Link to BLink:NP_839972.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_839972.1 351 Q810W6 351 100% 0 0

Chromosomal Locations for CCDS 15041.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 74191806 74192861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1056 nt):
ATGGCCGAGGCTGAATATTTCATCTGGACTAATCCTGAGGGTGACTTTGAGAAAGAATTTGGAAATATCA
CG
GGAATGCTGCCCACTGGAGATTATTTCATCCCCTGTAAGAGAGTTCCAATAACCAACAGGCAGGCTTT
A
GTTGTCTTTTATGCACTGGTGTCCCTTCTGAGCTTGCTGGGAAACTCGCTGGTGATGCTGGTTATCTTA
TAC
AGGCGAAGGACCCGATCCGTCATGGATGTCTACGTGCTGAACCTAGCCATCGCCGACCTACTCTTTT
CA
TTGACCCTGCCCTTCTTGGCTGTCTCCAAATTGAAGGGCTGGATTTTTGGCACACCCCTGTGCAAGAT
G
GTCTCACTCCTGAAGGAATTCAACTTCTTCAGTGGTATCCTGCTGCTGGCCTGCATCAGTGTGGACCGA
TAC
CTGGCCATCGTCCATGCCACCCGTACGCTGGCCCGAAAGCGCTACTTGGTTAAATTCGTGTGCGTGG
GC
ATCTGGGGTCTATCTTTGATTCTGTCTCTGCCTTTTGCTATCTTCCGCCAGGCATATAAACCATTCCG
T
TCTGGTACAGTCTGCTATGAAGTCCTGGGTGAAGCCACAACAGATTTTCGGATGACCTTGCGGGGTCTG
TCC
CACATATTTGGCTTCCTCCTGCCGCTGCTCACTATGCTGGTCTGCTACGGGCTCACACTGCGCATGC
TC
TTTAAGACCCACATGAGGCAGAAACACCGGGCCATGGGGGTGATCTTTGCTGTTGTGTTGGTCTTCTT
G
CTCTGTTGTCTGCCCTACAATCTGGTTCTGCTCTCAGACACTCTCTTAGGAGCCCACTTGATTGAAGAT
ACT
TGCGAACGCCGCAATGACATTGACCAGGCCCTGTATATTACTGAGATCCTGGGCTTTTCTCATAGTT
GT
CTTAACCCTATCATCTATGCCTTCGTTGGCCAAAATTTTCGCCATGAATTCCTCAAGATCCTTGCTAA
C
CATGGCCTGGTTCGCAAGGAGGTTTTGACACACCGCCGTGTTGCCTTTCATACGTCTCTCACCGCTATT
TAT
TAA


Translation (351 aa):
MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQALVVFYALVSLLSLLGNSLVMLVIL
Y
RRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSKLKGWIFGTPLCKMVSLLKEFNFFSGILLLACISVDR
Y
LAIVHATRTLARKRYLVKFVCVGIWGLSLILSLPFAIFRQAYKPFRSGTVCYEVLGEATTDFRMTLRGL
S
HIFGFLLPLLTMLVCYGLTLRMLFKTHMRQKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIED
T
CERRNDIDQALYITEILGFSHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRRVAFHTSLTAI
Y




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser