NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48286.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48286.1 Public Mus musculus 1 Abca12 16 104 75 CCDS HistoryNCBI Gene:74591Re-query CCDS DB by CCDS ID:48286.1See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48286.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000087268 ENSMUSP00000084523 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000087268Link to Ensembl Protein Viewer:ENSMUSP00000084523Re-query CCDS DB by Nucleotide ID:ENSMUST00000087268Re-query CCDS DB by Protein ID:ENSMUSP00000084523
Original member Current member NCBI NM_175210.3 NP_780419.2 Accepted alive Link to Nucleotide Sequence:NM_175210.3Link to Protein Sequence:NP_780419.2Re-query CCDS DB by Nucleotide ID:NM_175210Re-query CCDS DB by Protein ID:NP_780419Link to BLink:NP_780419.2

Chromosomal Locations for CCDS 48286.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 71243297 71243404 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71244732 71244869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71247132 71247237 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71248345 71248437 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71249855 71249958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71258091 71258225 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71259358 71259499 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71259789 71259898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71260781 71260985 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71263412 71263665 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71264724 71264883 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71265862 71265977 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71267429 71267606 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71268182 71268236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71272364 71272469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71274413 71274500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71276071 71276198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71278812 71278905 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71279375 71279461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71280341 71280593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71282802 71282952 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71283945 71284181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71285578 71285738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71286459 71286655 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71288538 71288756 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71291332 71291518 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71292414 71292569 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71293381 71293515 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71293601 71293670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71294727 71295056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71300920 71301034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71302631 71302946 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71303466 71303645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71307036 71307126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71309768 71309887 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71312561 71312700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71313959 71314169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71314478 71314642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71317100 71317273 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71319873 71319994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71321400 71321512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71321595 71321851 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71329164 71329270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71330247 71330365 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71335692 71335761 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71341463 71341575 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71346586 71346764 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71349017 71349202 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71351708 71351805 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71353670 71353761 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71362601 71362754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71401651 71401744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 71414514 71414582 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7788 nt):
ATGGCTTCCCAGTTTCATCAGCTTCGGATCCTGGTGTGGAAAAATTGGCTAGGTGTCAAAAGGCAGCCGC
TT
TGGACACTTGTCTTGATCTTATGGCCAGTCATTATTTTCATAATTCTGGCTATTACCCGGACAAAATT
C
CCGCCAACAGCAAAACCAACTTGTTACCTCGCACCTCGAAACCTTCCCAGTGCTGGATTCTTCCCATTC
CTA
CAAACCCTGCTCTGTGACACAGACTCTAAATGTAAAGACACGCCCTATGGACCACGAGATCTGCTCC
GC
AGGAAGGGGATTGATGGACCGCTATTTAAAGAAAGCGAAATTCTGAAAAAGCCGTCCAACCCGAAGAG
G
GACAGCAATTTATCACTCCGGAGCACCCAAGTTCCAGAAAGAAGTCACACATCATTGGCCACAGTACCT
CCA
AGACCAAGCTATGATTTGGAAGGAACAGGCACAGAAAATTTCAATGGTAGCCAATTGCTTACACGCA
TC
CTTGGTTTGGAAAAGCTGCTGAAGCAAAATTCAACTCCAGAAGACATACGAAGAGAGCTGTGTGAGAG
C
TACCCTGGGTACACTGCGGACTATGCCTTCTCTTGGGTCACCCTAGGAAAAAACGTTTTTAACAAATTT
TGC
CTTTCGAACATGACACTTTTAGAGTCTTCACTCCAGGAACTAAAATATCAAGTCTCTCAGATGTCAA
GT
GACCCCGACAATCAGAAGAGGGTGTTCCGGGGACTTGTCCAGGTGCTGTCCTTTTTCTCTCAAGTGCA
G
CAGCAAAGAGAAGTGTGGCAACTTCTGTCGAGCTTACCAGATGTGTTTCAGAATGGCACCTCATTGAGC
AGT
CTATTTGGTGTTCTTCAAAAGGCAAACAGGGTGCTGCTGGTAGTGCAGAAGGTTTACCCACGTGTTC
AA
ACTGATGAAGGATTCAGCACCCTCCAGAAGTCTGTTAAACATCTGCTGAACACTCTGGACTCCCCAAT
G
CAAGGTGACAATTCAACGCACGCATGGAGTGATGATGATGAGCAGACACTGTCCCCGAGCAGTCTGGCT
GCA
CAGCTCCTGATCCTGGAAAACTTTGAAGATGCCATCTTGAACATATCATCAAATAGTCCATATTCTC
CT
TATTTGGCGTGTGTAAGGAACATGACTGACAACTTGGCTAAGGGATCACCAGACAATCTAAAACTTCT
G
CAGTCCACAATTCACTTCAGAAAATCTTTCCTTCAAAATGGCTCCTCCGAGGACAGCTTCCCTCCATTT
CTT
GAGATCCTGAAATCCAAGCTGTCTCAACTTCGAAATTTGACGGAACTTCTCTGCGAATCAGAGACTT
TC
AGTTCGATCAAGAAGTCTTGCCAGTTCTCTAACATGAGCTTCGAGAGGCTGTGTGAAGACCATGCCTT
T
CACGTGCAACTGATTGAAGCGGCAGAGCTGGGCACTGACCTCACCACTGGCTTACTGTACCATGACAAT
ATA
ATATCTGCAAAGCTGAGGGGTTTGCTCACTGGAGATCCCAGCAAAATTAATCTCAATGTGGACTGGC
TC
CTGGAACAGGCATTGCAAATGAATTACTTGGAGAATATCACACGGCTCATACCAACCGTAGAGGCCAT
G
CTGCATGTCAACACCAGTGCAGACGCTTCTGAGAAGCCAGGTCAATTAAGAGAAATGTTTAAAAACATA
GAT
TTGCTGAAAGAAGATCTGAGGGCGATAGGGATGTCCAACACAAGTATCGACAAGCTGTTGGCCATTC
CC
ATTCCAGACAATAGAGCCGAGATAATTTCTCGTGTATTCTGGTTGCACTCATGTGATACCAACGTCAC
C
AACCCCAAACTGGAAGATGCCATGAAGGAGTTCTGCAAGCTGCCTCTTCCAGAGAGATCACATCAGTCC
TAC
CTCATCGGACTCACCCTTCTGCACTACTTAGACATTTACAATTTCACATACAAGGTGTTTTTCCCAA
GG
AAGGATCAAAAGCCAATGGAAAGGATGATGGAGCTTTTCATAAAGCTGAGAGAGATTCTCAATCAGTT
G
GCTTCCGGCACACATCCACTGCTGGACAAAATGAGATCCCTGAGACAAATGCACCTGCCCAGGAGTGTT
CCA
TTAACACAGGCCATGTACAGAAACACTCGAATGAACTCGCCAGCAGGATCGTTCAGTACTATCTCCC
AG
GCTCTGTGCTCCCAGGGGATCACCACCGAGTACTTAACTGCTATGCTGCCTTCTTCCCAGAAGCCAAA
A
GGCAACCACACCAAGGATTTTCTCACTTATAAATTAACTAAAGAAGAAATTGCTTCAAAATACGGGATT
CCT
TTAAATGCTACACCATTTTGCTTCTCCCTTTACAAAGACATCATTAACATGCCTGCTGGGCCTGTGA
TT
TGGGCCTTCTTGAAACCCATGTTGTTGGGAAAGATTTTATATTCACCATATAACCCAACTACAAAGGC
C
ATTATGGAAAAGTCCAATGTAACTCTAAGACAGCTGGCGGAATTAAGAGAAAAATCTCAGGAGTGGATG
GAT
AAGTCACCAATTTTCATGAATTCCTTCCACCTGCTAAACCAGACGATCCCAATGCTCCAGAATACTC
TA
CGGAACCCCTTTGTGCAAGTTTTTGTGAAGTTCTCCGTGGGACTCGATGCTGTCGAACTCCTGAAGCA
G
ATAGACGACCTTGATGTTCTCAGGCTGAAATTAGTGAACAACATTGACATCATTGATCAGCTCAACACA
CTG
TCTTCCCTGACTGTAAATATTTCCTCCTGTGTTCTTTACGACCGTATTCAGGCGTCAGACACTGTAG
AG
GAGATGGAGACGGTGGCCGAACAACTCTACAAGAGCAACGAGCTCTTTGGAAGTGTCATTTTTAAGCT
T
CCATCTAACGGAAGTTTGCACAGAGGGTTTGACCCTGAAAAAGTGTCTCTTCCTCCTATCGTAAGATAT
ACC
ATCCGCATGAGTCTGAAGACGGCACAGACCACAAGGAGCATAAGAACAAAGATCTGGGCCCCAGGGC
CA
CACAACTCTCCATCCCATAACCAGATCTATGGCCGGGCTTTCATTTATCTGCAGGATAGCATTGAGAG
A
GCAATTATTGAGTTACAAACAGGAAGGAACTCACAGGAAGTCGCCGTCCAGGTTCAAGCGGTTCCTTAT
CCC
TGCTTCATGAAGGACAATTTCCTCACCAGTGTCTCCTATTCCCTCCCGATTGTGCTTATGGTCGCCT
GG
GTTGTATTTATAGCTGCCTTTGTTAAAAAGCTAGTCTACGAGAAGGACCTTCGGCTCCATGAGTACAT
G
AAGATGATGGGTGTCAACTCCTGCAGCCATTTCTTTGCCTGGCTTATAGAGAGTATTGGGTTCTTGCTG
GTC
ACCATTGCAATCCTCATCGTTATCCTCAAGTTTGGCAATATTCTTCCCAAGACAAACGGCTTCATTT
TG
TTCCTGTACTTCTCAGACTACAGCTTCTCAGTGATTGCCATGAGCTATCTCATCAGTGTCTTCTTCAA
C
AACACCAACATTGCAGCTCTGATTGGAAGCCTCATCTATGTCATCGCCTTTTTCCCATTTATTGTTCTG
GTT
ACAGTTGAGGATGAGCTGAGCTACGTTATTAAAGTATTCATGAGCCTGCTGTCCCCGACAGCATTCA
GC
TATGCAAGCCAATATATTGCACGGTATGAAGAACAAGGCGTTGGTCTTCAGTGGGAAAATATGTACAA
A
TCCCCTGTTCAGGATGACACCACCTCATTTGGCTGGCTGTGCTGTCTAATCCTAGCAGACTCCTTCATT
TAT
TTCTTTATTGCTTGGTACGTCAGGAATGTTTTCCCAGGGACATATGGAATGGCAGCTCCATGGTATT
TT
CCCATCCTTCCTTCCTATTGGAAAGAGCGCTTTGGATGCGCAGAGGTGAAGCATGAGAAAAGCAATGG
C
TTAATGTTTACTAATATCATGATGCAGAACACCAACCCTTCTGCCAGTAAGACAAGTCCTGACTGTGCA
TTT
CCCTCCAACATTGAACCTGAACCTAAAGATCTCCAAGTTGGAGTTGCCCTTCATGGGGTCACAAAGA
TC
TATGGCTCAAAAACAGCTGTTGAGAACCTCAATCTGAACTTCTACGAAGGGCACATTACATCACTGTT
G
GGGCCAAACGGAGCTGGCAAAACCACAACAATCTCCATGCTGACTGGGCTGTTTGGTGCCACAGCGGGT
ACC
ATTTTTGTATACGGAAAAGATATCAAGACAGACCTGAATACTGTTCGGAAAAACATGGGGGTCTGCA
TG
CAACATGACGTCTTGTTCAGTTACCTAACCACCAAGGAACACCTTCTCCTGTATGGCTCCATCAAAGT
T
CCTCACTGGACCAAAACACAGCTCCATGAGGAGGTTAAAAGGACTTTAAAAGACACTGGACTGTATAGT
CAT
CGCCATAAGAGAGTTGGAACGTTGTCGGGAGGAATGAAGAGGAAGTTGTCCATATCCATAGCTCTCA
TC
GGTGGCTCCAGGGTAGTGATTTTGGATGAACCATCCACGGGCGTTGACCCATGTTCTCGCCGAAGCAT
A
TGGGATGTCATATCCAAGAACAAAACTGCAAGAACAATCATTCTGTCCACACACCACTTGGATGAGGCC
GAA
GTGCTGAGTGACCGCATCGCCTTCCTGGAACAGGGTGGGCTCCGGTGCTGTGGATCTCCATTTTACC
TC
AAGGAAGCTTTTGGGGATGGTTACCACCTCACACTCACCAAGAAGAAGAGTCCAAACCTAGACACAAA
T
GCAATCTGTGACACAGTGGCAGTGACAGCAATGATCCAGTCGCACCTTCCTGAAGCCTACCTCAAAGAG
GAT
ATTGGGGGAGAGCTTGTATATGTGCTCCCTCCATTCAGCACGAAAGTCTCAGGAGCTTACCTGTCCC
TC
CTGAGAGCACTGGACAAGGGCATGGGTAAACTCAACATCGGCTGCTATGGCATTTCAGACACCACTGT
T
GAAGAGGTCTTCCTGAACTTGACAAAAGATTCGCAAAAAAGTAGTAATATGAGTCTGGAGCACTTAACA
CAG
AGGAAAGTTGGGAACCCCAGTGCCAACGGGACCTCCACTCCTGACGACCTGTCTGTGAGCAGCAGCA
AC
TTCACCGACAGAGACGACAAAGTCCTGACAAGAAGCGAGAAGCTGGAGGGCTTTGGACTCTTACTGAA
G
AAGATAATGGCTATTCTCATCAAGAGGTTCCACCACACCCGCCGGAACTGGAAAGGTCTCATTGCTCAG
GTC
ATTCTCCCCATCGTCTTTGTAGCCACGGCCATGGGTCTCGGCACACTGAGAGATTCCAGCAACAGTT
AC
CCAGAGATCATGATCTCTCCGTCCATTTACGGCACCTCCGAACAGACAGCCTTCTACGCGAATTTTGA
T
CCAAGCACCAGTGGTCTGGTCTCAGCTCTCTGGAATTTCCCTGGCATTGACAATGTGTGTTTGAATACT
AGT
GACTTGCAGTGTTTAAAAAAAGATGATCTGGGAAAGTGGAACACAAGTGGAGAAGCTATCGACAACT
TT
GGTGTTTGCTCCTGTTCCGACAATGTCCAGGAATGCCCCAAATTCAACTATCATCCACCTCATAGAAG
A
ACTTACTCTTCCCAAGTTATTTATAACCTCACTGGAAAACACATGGAAAATTATCTTATAACAACTGCA
AAT
CATTTTGTGCAGAAAAGATATGGAGGTTGGAGTTTTGGGATGAAATTGACTAACGACCTTCGTTTTG
AT
GTGACAGCTGTCCCTGACAATAGAACTCTTGCTAAGGTGTGGTACGATCCGGAAGGCTACCATTCCCT
C
CCAGCTTACCTCAACAGCCTCAACAACTTCCTCCTGAGGGTTAACATGTCAGAGTACGATGCTGCCCGA
CAC
GGGATCATCATGTATAGCCACCCTTATCCAGGGGTACAAGACCAGGAACAAGCCACAATCAGCAGTT
TA
ATCGATATTTTAGTGGCGCTGTCCATCCTGATGGGCTACTCTGTCACCACTGCCAGCTTTGTCACCTA
C
ATTGTCAGGGAACATCAGACCAAAGCCAAGCAGTTGCAGCACATTTCTGGCATCGGTGTGACGTGCTAC
TGG
GTGACAAATTTCATCTATGACATGGTCTTCTATTTGGTTCCTGTAGCATTTTCAATTGGTGTCATCG
CA
ATTTTCAAGCTTCCTGCCTTCTACAGTGGAAACAATCTAGGCGCTGTATCCCTCCTACTTTTGCTGTT
T
GGCTATGCAACATTTTCTTGGATGTACCTGCTGGCTGGCCTCTTCCACGAAACAGGAATGGCCTTCATC
ACT
TATGTGTGTGTCAACCTGTTCTTTGGTATCAATTCCATCGTTTCCCTGTCGGTGGTATACTTCCTTT
CC
AAGGAAAAGCCTAATGACCCGACGCTAGAACTTATTTCTGAAACTCTCAAGCGGATTTTCCTGATCTT
C
CCCCAATTCTGTTTTGGCTACGGTTTGATTGAACTTTCTCAGCAACAGGCAGTCTTGGATTTCTTAAAA
GCC
TACGGTGTGGAATATCCAAGCGAGACCTTTGAGATGGATAAGCTGGGGGCAATGTTTGTGGCCTTGG
TT
TCTCAGGGCACCATGTTTTTCTTGTTGCGACTCCTCATCAATGAGTGGCTGATAAAGAAGCTCAGGCT
C
TTCTTCAGGAAATTTACATCTTCGCCTATCATGGAGACAGTAGATGAAGATGAAGATGTGCGGGCTGAG
AGA
TTTCGAGTTGAGAGTGGTGCAGCTGAGTTTGACCTGGTCCAGCTCCATCGTCTCACAAAGACCTACC
AG
CTGATCCACAAGAAGATTATAGCTGTCAACAACATCAGCCTGGGGATACCTGCTGGAGAGTGTTTTGG
C
CTCCTTGGTGTGAACGGAGCAGGGAAAACCACTATATTTAAGATGCTGACTGGAGACATAATTCCTTCC
AGT
GGAAACATTCTGATCAGAAACAAGAGCGGATCCCTGGGACATGTGGATTCTCACAGCTCTTTGGTTG
GC
TACTGCCCTCAGGAGGACGCTTTAGATGACCTAGTAACTGTGGAAGAGCACTTGTATTTCTATGCCAG
A
GTGCATGGGATTCCAGAGAAGGACATCAAAGACACTGTTCATAAACTCCTTAGGAGACTTCACTTGATG
GCC
TACAAGGACAGATCTACCTCCATGTGCAGTTACGGCACAAAAAGGAAGCTGTCCACTGCCCTGGCCT
TG
ATAGGGAAACCGTCCATCCTCCTGCTGGATGAGCCAAGCTCTGGGATGGATCCCAAGTCAAAACGACA
C
CTCTGGAGGATCATTTCAGAAGAGGTGCAGAACAAATGCTCTGTCATCCTCACATCTCACAGCATGGAA
GAA
TGTGAAGCTCTTTGTACCCGGCTGGCCATTATGGTGAACGGAAGGTTCCAGTGCATTGGGTCTCTGC
AA
CACATAAAAAGCAGGTTTGGACGTGGATTTACTGTCAAGGTTCACTTGAAAAATAATAAAGTGAGCAT
G
GAAACCCTCACGAAGTTTATGCAGCTACACTTTCCAAAAACATACTTAAAAGATCAGCACCTGAGCATG
CTG
GAGTACCACGTGCCAGTCACAGCAGGAGGGGTCGCAAACATCTTTGACCTTCTGGAAACCAACAAGA
CT
GCTTTAAATATCACAAATTTCCTCGTGAGCCAGACCACTTTGGAGGAGGTTTTCATCAACTTTGCCAA
A
GACCAAAAATCCTACGAAAATGTTGATACCAGTAGCCAAGGTTCCACCATAAGTGTAGACTCACAGGAA
GAT
CAACTAGATTCTTAG


Translation (2595 aa):
MASQFHQLRILVWKNWLGVKRQPLWTLVLILWPVIIFIILAITRTKFPPTAKPTCYLAPRNLPSAGFFPF
L
QTLLCDTDSKCKDTPYGPRDLLRRKGIDGPLFKE
SEILKKPSNPKRDSNLSLRSTQVPERSHTSLATVP
P
RPSYDLEGTGTENFNGSQLLTRILGLEK
LLKQNSTPEDIRRELCESYPGYTADYAFSWVTLGKNVFNKF
C
LSNMTLLESSLQELKYQVSQ
MSSDPDNQKRVFRGLVQVLSFFSQVQQQREVWQLLSSLPDVFQNGTSLS
S
LFGVLQKAN
RVLLVVQKVYPRVQTDEGFSTLQKSVKHLLNTLDSPMQGDNSTHAWSDDDEQTLSPSSLA
A
QLLILENFEDAILNISSNSPYSPYLACVRNMTDNLAKGSPDNLKLLQSTIHFRKSFLQNGSSEDSFPPF
L
EILKSK
LSQLRNLTELLCESETFSSIKKSCQFSNMSFERLCEDHAFHVQLIEAAELGTDLTTGLLYHDN
I
ISAKLRGLLTGDPSKINLNVD
WLLEQALQMNYLENITRLIPTVEAMLHVNTSADASEKPGQLREMFKNI
D
LLKEDLRAIGMSNTSIDKLLAIPIPDNRAE
IISRVFWLHSCDTNVTNPKLEDAMKEFCKLPLPERSHQS
Y
LIGLTLLHYLDIYNFTYK
VFFPRKDQKPMERMMELFIKLREILNQLASGTHPLLDKMRSLRQMHLPRSV
P
LTQ
AMYRNTRMNSPAGSFSTISQALCSQGITTEYLTAMLPSSQKPKGNHTKDFLTYKLTKEEIASKYGI
P
LNA
TPFCFSLYKDIINMPAGPVIWAFLKPMLLGKILYSPYNPTTKAIMEKSNVTLRQLAELREKSQEWM
D
KSPIFMNSFHLLNQTIPMLQ
NTLRNPFVQVFVKFSVGLDAVELLKQIDDLDVLRLKLVNNIDIIDQLNT
L
SSLTVNISSCVLYDRIQASDTVEEMETVAEQLYKSNELFG
SVIFKLPSNGSLHRGFDPEKVSLPPIVRY
T
IRMSLKTAQTTRSIRTKIWAPGPHNSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEVAVQVQAVPY
P
CFMKD
NFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESIGFLL
V
TIAILIVILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYVIAFFPFIVL
V
TVEDELSYVIKVFM
SLLSPTAFSYASQYIARYEEQGVGLQWENMYKSPVQDDTTSFGWLCCLILADSFI
Y
FFIAWYVRNVFP
GTYGMAAPWYFPILPSYWKERFGCAEVKHEKSNGLMFTNIMMQNTNPSASKTSPDCA
F
PSNIEPEPKDLQVGVALHGVTKIYGSKTAVENLNLNFYEGHITSLLGPNGAGKTTT
ISMLTGLFGATAG
T
IFVYGKDIKTDLNTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKTQLHEEVK
RTLKDTGLYS
H
RHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKT
ARTIILSTHHLDEA
E
VLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKK
SPNLDTNAICDTVAVTAMIQSHLPEAYLKE
D
IGGELVYVLPPFSTKVSGAYLSLLRALDKGMGKLNIGCYGISDTTVEE
VFLNLTKDSQKSSNMSLEHLT
Q
RKVGNPSANGTSTPDDLSVSSSNFTDRD
DKVLTRSEKLEGFGLLLKKIMAILIKRFHHTRRNWKGLIAQ
V
ILPIVFVATAMGLGTLRDSSNSYPEIMISPSIYGTSEQTAFY
ANFDPSTSGLVSALWNFPGIDNVCLNT
S
D
LQCLKKDDLGKWNTSGEAIDNFGVCSCSDNVQECPKFNYHPPHRRTYSSQVIYNLTGKHMENYLITTA
N
HFVQK
RYGGWSFGMKLTNDLRFDVTAVPDNRTLAKVWYDPEGYHSLPAYLNSLNNFLLRVNMSEYDAAR
H
GIIMYSHPYPGVQDQEQATISSLIDILVALSILMGYSVTTASFVTYIVREHQTKAKQLQHISGIGVTCY
W
VTNFIYDM
VFYLVPVAFSIGVIAIFKLPAFYSGNNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFI
T
YVCVNLFFGINSIVSLSVVYFLSKEKPNDP
TLELISETLKRIFLIFPQFCFGYGLIELSQQQAVLDFLK
A
YGVEYPSETFEMDKLGAMFVALVSQGTMFFLLRLLINEWLIKKL
RLFFRKFTSSPIMETVDEDEDVRAE
R
FRVESGAAEFDLVQLHRLTKTYQLIHKKIIAVNNISLGIPAGE
CFGLLGVNGAGKTTIFKMLTGDIIPS
S
GNILIRNKS
GSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKDTVHKLLRRLHLM
A
YKDRSTSMCSYGTKRKLSTALALIGKPSILLL
DEPSSGMDPKSKRHLWRIISEEVQNKCSVILTSHSME
E
CEALCTRLAIMVNGRFQCIGSLQHIKS
RFGRGFTVKVHLKNNKVSMETLTKFMQLHFPKTYLKDQHLSM
L
EYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEE
VFINFAKDQKSYENVDTSSQGSTISVDSQE
D
QLDS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser