NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21826.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21826.1 Public Mus musculus 7 Spns1 16 104 75 CCDS HistoryNCBI Gene:73658Re-query CCDS DB by CCDS ID:21826.1

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21826.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032994 ENSMUSP00000032994 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032994Link to Ensembl Protein Viewer:ENSMUSP00000032994Re-query CCDS DB by Nucleotide ID:ENSMUST00000032994Re-query CCDS DB by Protein ID:ENSMUSP00000032994
Original member Current member EBI,WTSI OTTMUST00000077915 OTTMUSP00000041308 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000077915Link to Vega Protein Viewer:OTTMUSP00000041308Re-query CCDS DB by Nucleotide ID:OTTMUST00000077915Re-query CCDS DB by Protein ID:OTTMUSP00000041308
Original member Current member NCBI NM_023712.3 NP_076201.2 Accepted alive Link to Nucleotide Sequence:NM_023712.3Link to Protein Sequence:NP_076201.2Re-query CCDS DB by Nucleotide ID:NM_023712Re-query CCDS DB by Protein ID:NP_076201Link to BLink:NP_076201.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_076201.2 528 Q8R0G7 528 100% 0 0

Chromosomal Locations for CCDS 21826.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 126370319 126370413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126370735 126370906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126371178 126371276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126371541 126371606 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126371958 126372147 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126372412 126372567 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126372745 126372890 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126373770 126373836 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126373922 126374073 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126375067 126375203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126376674 126376739 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 126376837 126377077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1587 nt):
ATGGCCGGGTCCGACACGGCGCCCTTCCTCAGCCAAGCAGATGATCCTGATGACGGGCCAGCGCCCGGCC
AT
CCGGGGTTGCCAGGACCCATGGGGAATCCAAAGTCCGGGGAACTCGAGGTCCCAGACTGTGAGGGGCT
A
CAGCGCATCACTGGCTTATCTCGGGGCCATTCGACCCTCATAGTGGTGGTTCTGTGCTACATTAACCTC
CTG
AACTACATGGACCGCTTCACCGTGGCAGGGGTTCTTACAGACATCGAGCAGTTCTTTAACATCGGAG
AT
GGTAGTACTGGCCTCATCCAGACTGTGTTCATCTCCAGTTACATGGTGTTGGCACCAGTGTTTGGCTA
C
CTGGGTGACAGGTACAATCGAAAGTACCTCATGTGCGGGGGCATTGCCTTCTGGTCCCTGGTGACACTG
GGA
TCATCCTTCATCCCCAGAGAGCATTTCTGGCTGCTTCTCCTGACCCGGGGCCTGGTGGGGGTCGGGG
AG
GCCAGTTACTCCACCATTGCGCCCACCCTGATCGCCGACCTCTTCGTGGCAGACCAGCGGAGTCGGAT
G
CTCAGTATCTTCTACTTTGCCATCCCTGTGGGCAGTGGTCTAGGTTACATTGCTGGCTCCAAAGTGAAA
GAC
GTGGCTGGAGACTGGCACTGGGCTCTACGGGTGACACCAGGTCTAGGAGTGCTGGCTGTCCTGCTGC
TG
TTCCTGGTGGTCCAGGAGCCCCCAAGAGGAGCCGTGGAGCGCCACTCAGGTTCACCACCCCTGAGCCC
C
ACCTCTTGGTGGGCAGATCTGAAGGCACTGGCACGAAATCCTAGTTTCGTCCTGTCTTCCCTTGGCTTC
ACC
TCTGTGGCCTTTGTCACGGGCTCCCTGGCTCTCTGGGCCCCAGCGTTCCTGCTGCGCTCCCGGGTTG
TT
CTGGGAGAGACTCCGCCCTGTCTCCCTGGAGATTCATGCTCTTCCTCTGACAGTCTCATCTTTGGACT
C
ATCACTTGCCTGACTGGAGTCCTGGGTGTGGGCCTGGGAGTGGAGATCAGCCGCCGCCTTCGCCGCTTC
AAC
CCTCGGGCTGACCCACTCGTCTGTGCAGCTGGCCTCCTGGGTTCGGCGCCTTTCCTCTTCCTGGCCC
TG
GCCTGTGCCCGAGGTAGCATCGTGGCCACCTATATTTTTATCTTTATTGGGGAGACCCTGTTGTCCAT
G
AACTGGGCCATTGTGGCTGACATCCTGTTGTACGTGGTGATCCCAACTCGACGGTCCACGGCTGAGGCC
TTC
CAGATAGTGCTGTCCCACTTGCTAGGAGATGCAGGGAGCCCTTACCTCATTGGTCTAATCTCTGACC
GC
CTCCGACGGAGCTGGCCCCCTTCCTTCCTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTG
T
GCTTTCGTTGGGGCACTGGGTGGTGCGGCCTTCCTGGGCACCGCCATGTTCATTGAAGATGACCGCCGG
CGG
GCTCAACTCCACGTGCAGGGTCTGTTGCATGAGTCTGGGCCCTCAGATGACCGGATTGTAGTACCTC
AG
CGAGGCCGTTCTACCCGAGTCCCCGTGTCCAGCGTGCTCATCTGA


Translation (528 aa):
MAGSDTAPFLSQADDPDDGPAPGHPGLPGPMGNPKSGELEVPDCEGLQRITGLSRGHSTLIVVVLCYINL
L
NYMDRFTVA
GVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTL
G
SSFIPRE
HFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVK
D
VAGDWHWALR
VTPGLGVLAVLLLFLVVQEPPRGAVERHSGSPPLSPTSWWADLKALARNPSFVLSSLGF
T
SVAFVTGSLALWAPAFLLRSRVVLGETPPCLPGDSCSSSD
SLIFGLITCLTGVLGVGLGVEISRRLRRF
N
PRADPLVCAAGLLGSAPFLFLALACARGSIVATY
IFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEA
F
QIVLSHLLGDAGSPYLIGL
ISDRLRRSWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAMFIEDDRR
R
AQLHVQ
GLLHESGPSDDRIVVPQRGRSTRVPVSSVLI



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser