NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15309.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15309.1 Public Mus musculus 1 Adipor1 16 104 75 CCDS HistoryNCBI Gene:72674Re-query CCDS DB by CCDS ID:15309.1See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15309.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027727 ENSMUSP00000027727 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027727Link to Ensembl Protein Viewer:ENSMUSP00000027727Re-query CCDS DB by Nucleotide ID:ENSMUST00000027727Re-query CCDS DB by Protein ID:ENSMUSP00000027727
Original member Current member EBI,WTSI ENSMUST00000112237 ENSMUSP00000107856 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112237Link to Ensembl Protein Viewer:ENSMUSP00000107856Re-query CCDS DB by Nucleotide ID:ENSMUST00000112237Re-query CCDS DB by Protein ID:ENSMUSP00000107856
Original member Current member EBI,WTSI OTTMUST00000051762 OTTMUSP00000024419 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051762Link to Vega Protein Viewer:OTTMUSP00000024419Re-query CCDS DB by Nucleotide ID:OTTMUST00000051762Re-query CCDS DB by Protein ID:OTTMUSP00000024419
Original member Current member EBI,WTSI OTTMUST00000051763 OTTMUSP00000024420 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051763Link to Vega Protein Viewer:OTTMUSP00000024420Re-query CCDS DB by Nucleotide ID:OTTMUST00000051763Re-query CCDS DB by Protein ID:OTTMUSP00000024420
Original member Current member NCBI NM_028320.3 NP_082596.2 Accepted alive Link to Nucleotide Sequence:NM_028320.3Link to Protein Sequence:NP_082596.2Re-query CCDS DB by Nucleotide ID:NM_028320Re-query CCDS DB by Protein ID:NP_082596Link to BLink:NP_082596.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082596.2 375 Q91VH1 375 100% 0 0

Chromosomal Locations for CCDS 15309.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 134423015 134423155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 134423958 134424074 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 134424751 134424922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 134425909 134426095 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 134428082 134428269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 134431057 134431250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 134431530 134431658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1128 nt):
ATGTCTTCCCACAAAGGCTCTGCCGGGGCACAAGGCAATGGGGCTCCTTCTGGTAACAGAGAAGCTGACA
CA
GTGGAGCTGGCTGAGCTGGGGCCCCTGCTGGAGGAGAAGGGCAAGCGGGCAGCCAGCAGCCCAGCCAA
G
GCTGAGGAAGATCAAGCATGCCCGGTGCCTCAGGAAGAGGAGGAGGAGGTGCGGGTGCTGACGCTTCCT
CTG
CAAGCCCACCATGCCATGGAGAAGATGGAGGAGTTCGTGTATAAGGTCTGGGAGGGACGTTGGAGAG
TC
ATCCCGTATGATGTGCTTCCTGACTGGCTGAAAGACAACGACTACCTGCTACATGGCCACAGACCACC
T
ATGCCCTCCTTTCGGGCTTGCTTCAAGAGCATCTTCCGCATCCACACAGAGACTGGCAACATCTGGACA
CAT
CTGCTTGGTTTTGTGCTATTTCTCTTTCTGGGAATCTTGACGATGCTGAGACCAAATATGTACTTCA
TG
GCTCCCCTGCAGGAGAAGGTGGTCTTCGGGATGTTCTTCCTGGGCGCGGTGCTCTGCCTCAGTTTCTC
C
TGGCTCTTCCACACTGTCTACTGTCATTCAGAGAAGGTCTCTCGGACTTTTTCCAAACTGGACTATTCA
GGG
ATTGCTCTACTGATTATGGGGAGCTTCGTTCCCTGGCTCTATTACTCCTTCTACTGCTCCCCACAGC
CG
CGGCTCATCTACCTCTCCATCGTCTGTGTCCTGGGCATCTCTGCCATCATTGTGGCACAGTGGGACCG
G
TTTGCCACTCCCAAGCACCGGCAGACAAGAGCAGGAGTGTTCCTGGGACTTGGCTTGAGTGGTGTTGTA
CCC
ACCATGCACTTTACTATCGCTGAGGGCTTTGTCAAGGCCACCACGGTGGGCCAGATGGGCTGGTTCT
TC
CTCATGGCTGTGATGTACATCACCGGCGCCGGCCTGTATGCTGCTCGGATTCCTGAGCGCTTCTTCCC
T
GGAAAATTTGACATCTGGTTCCAGTCTCATCAGATTTTCCACGTCCTGGTGGTGGCAGCAGCTTTCGTC
CAC
TTCTATGGTGTGTCCAACCTTCAGGAATTCCGTTATGGCCTAGAAGGTGGCTGTACCGACGACTCCC
TT
CTCTGA


Translation (375 aa):
MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSPAKAEEDQACPVPQEEEEEVRVLTLP
L
QAHHAMEKMEEFVYK
VWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT
H
LL
GFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS
G
IALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRA
GVFLGLGLSGVV
P
TMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIW
FQSHQIFHVLVVAAAFV
H
FYGVSNLQEFRYGLEGGCTDDSLL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser