NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28942.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28942.1 Public Mus musculus 17 Twsg1 16 104 75 CCDS HistoryNCBI Gene:65960Re-query CCDS DB by CCDS ID:28942.1

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28942.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024906 ENSMUSP00000024906 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024906Link to Ensembl Protein Viewer:ENSMUSP00000024906Re-query CCDS DB by Nucleotide ID:ENSMUST00000024906Re-query CCDS DB by Protein ID:ENSMUSP00000024906
Original member Current member NCBI NM_023053.3 NP_075540.1 Accepted alive Link to Nucleotide Sequence:NM_023053.3Link to Protein Sequence:NP_075540.1Re-query CCDS DB by Nucleotide ID:NM_023053Re-query CCDS DB by Protein ID:NP_075540Link to BLink:NP_075540.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_075540.1 222 Q9EP52 222 100% 0 0

Chromosomal Locations for CCDS 28942.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

Chromosome Start Stop Links
17 65926285 65926466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 65929547 65929813 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 65937801 65937900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 65948658 65948777 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (669 nt):
ATGAAGTCACACTATATTGTGCTAGCTCTAGCCTCCCTGACGTTCCTGCTGTGTCTCCCCGTGTCCCAGA
GC
TGTAACAAAGCACTCTGTGCCAGCGATGTGAGCAAATGCCTCATTCAGGAGCTCTGCCAGTGCCGGCC
T
GGAGAAGGGAACTGCCCCTGCTGTAAGGAGTGCATGCTGTGCCTCGGGGCCCTGTGGGACGAGTGCTGC
GAC
TGTGTCGGTATGTGCAACCCTCGGAATTACAGCGACACCCCGCCCACATCCAAGAGCACCGTGGAGG
AG
CTGCACGAGCCCATTCCGTCCCTGTTCAGGGCGCTGACGGAGGGCGACACCCAGCTGAACTGGAACAT
C
GTCTCCTTCCCTGTGGCAGAGGAGCTGTCACACCATGAAAACCTAGTCTCCTTCCTAGAAACTGTGAAC
CAG
CTGCACCACCAAAACGTGTCTGTTCCCAGCAACAATGTCCACGCCCCCTTCCCCAGCGACAAAGAGC
GC
ATGTGCACAGTGGTTTACTTTGATGACTGCATGTCCATCCACCAGTGTAAGATATCCTGCGAATCCAT
G
GGTGCATCCAAGTATCGCTGGTTTCACAACGCCTGCTGCGAGTGCATCGGTCCAGAGTGCATTGACTAT
GGG
AGTAAAACTGTCAAGTGTATGAACTGCATGTTTTAA


Translation (222 aa):
MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECC
D
CV
GMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVN
Q
LHHQNVSVPSNNVHAPFPSDK
ERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDY
G
SKTVKCMNCMF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser