NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17990.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17990.1 Public Mus musculus 4 Cngb3 16 104 75 CCDS HistoryNCBI Gene:30952Re-query CCDS DB by CCDS ID:17990.1

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17990.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102999 ENSMUSP00000100064 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102999Link to Ensembl Protein Viewer:ENSMUSP00000100064Re-query CCDS DB by Nucleotide ID:ENSMUST00000102999Re-query CCDS DB by Protein ID:ENSMUSP00000100064
Original member Current member EBI,WTSI OTTMUST00000010430 OTTMUSP00000004949 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000010430Link to Vega Protein Viewer:OTTMUSP00000004949Re-query CCDS DB by Nucleotide ID:OTTMUST00000010430Re-query CCDS DB by Protein ID:OTTMUSP00000004949
Original member Current member NCBI NM_013927.2 NP_038955.1 Accepted alive Link to Nucleotide Sequence:NM_013927.2Link to Protein Sequence:NP_038955.1Re-query CCDS DB by Nucleotide ID:NM_013927Re-query CCDS DB by Protein ID:NP_038955Link to BLink:NP_038955.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038955.1 694 Q9JJZ9 694 100% 0 0

Chromosomal Locations for CCDS 17990.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 19280933 19281043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19283506 19283581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19309531 19309657 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19364112 19364269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19366413 19366559 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19367712 19367920 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19375200 19375250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19379226 19379312 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19395926 19395990 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19396680 19396802 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19415646 19415787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19425490 19425649 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19428468 19428565 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19461675 19461758 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19481831 19481949 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19504442 19504588 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19505173 19505347 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 19508078 19508083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2085 nt):
ATGTTAAAATCACTGACAGTAAAATTCAACAAAGTGAATCCCATGGAAGGGAGAATGGAGAAGAAACTCT
GC
CCCAACCTGAGCAGTCTTTCTCAGCCAACCATAGCACAGGGAGACAACCAAAGTGAAAAAGAACCTCT
G
AGGAGCAGGACACCAATCACATTTGAAAAGTCACACAGCAAAGAAGACAACAGCACTGGGGAAAACTCT
CTC
AGAGATTTCACCCCAAATCCTGACCCTGAATGTCGAGCAGAACTCACCAGAACAATGGCAGAGATGG
AG
AAAACTAGGACTGGGAAAGAAAGGCCAGTCAGCTTTAAGACCAAAGTGCTTGAAACCTCAATTATAAA
T
GAATATACTGATGCCCACCTACACAACCTAGTGGAAAGAATGCGTGAAAGGACTGCTCTCTACAAGAAA
ACA
TTGACAGAGGAAGAAAATTTCCCAGAAGTGGAAGCCAGCTCTCAGACTGCAATGTCTACAAATATAT
CA
CCAAAACAAGAGAACAATTCCAAGCTAAAAGAACACCAAGACACGTTTTCTTTCAAACCCCAGAGAGT
C
CCAGTAAAAGAGCACCTACGAAGAATGATACTTCCCAGAAGCATAGACTCCTACACAGATCGGGTCTAT
CTC
TTGTGGCTCCTGCTTGTCACCATTGCGTATAACTGGAACTGTTGGCTGCTACCAGTGCGCCTCGTCT
TT
CCATGCCAAACACCAGATAACAAGAACTACTGGATTATTACTGACATCGTATGTGATATCATCTACCT
T
TGTGATATACTATTGATCCAGCCAAGACTCCAATTTGTAAGAGGAGGAGAAATTATTGTAGATTCAAAT
GAG
CTGAAGAGGAACTACCGGAGTTCTACAAAGTTTCGGATGGATGTGGCATCTCTACTGCCATTCGAAG
TT
CTCTACATCTTCTTTGGAGTTAATCCAATATTCAGAGCAAATCGGATATTAAAGTATACTTCATTCTT
T
GAGTTTAACCATCACCTGGAGTCTATAATGGACAAAGCATATGTCTACAGAGTCATCCGAACAACTGGC
TAC
TTGCTGTTTCTCCTGCACATTAACGCCTGTGTTTATTACTGGGCTTCAGACTATGAAGGAATTGGCT
CA
ACTAAATGGGTCTATAATGGTGAAGGCAACAAGTATCTGCGATGCTTTTATTGGGCAGTTCGAACTTT
A
ATTACTATCGGGGGCCTTCCAGAGCCACAGACTTCATTTGAAATTGTTTTTCAATTCTTGAATTTTTTC
TCT
GGGGTTTTTGTTTTCTCCAGCTTAATTGGTCAGATGCGTGATGTGATTGGGGCAGCAACAGCCAATC
AG
AACTACTTCCAAGCCTGCATGGACCATATCATTGCCTACATGAACAAATACTCTATTCCTCAGAGTGT
G
CAGTATCGAGTTCGGACTTGGCTGGAATATACATGGAACTCACAAAGAATCCTAGATGAGTCCAACTTG
CTT
GAGAACCTCCCGACAGCAATGCAGTTGTCTATTGCCCTTGACATAAACTTCAGTATCATCGACAAGG
TG
GAGTTATTCAAGGGCTGTGACACACAGATGATTTATGACCTGCTGCTAAGATTGAAATCCACTATTTA
T
TTACCTGGTGACTTTGTCTGCAAAAAGGGAGAAATTGGAAAAGAAATGTACATCATCAAACACGGAGAA
GTC
CAAGTCCTTGGAGGCCCTGATGGTGCTCAAGTTCTGGTTACTCTGAAAGCTGGGTCAGTGTTTGGAG
AA
ATAAGCCTTCTGGCAAAAGGAGGAGGAAATCGCCGGACAGCTGATGTTGTGGCCCACGGATTTGCCAA
T
CTTTTAACTCTGGACAAAAAGACTCTCCAAGAAATTCTGCTGCATTATCCAACTTCTAAAAAGCTCCTC
ATG
AAGAAAGCCAAAATTCTTTTAAGCCAGAAGGGAAAGACCACTCAGGCAATCCCTGCAAGACCAGGAC
CT
GCCTTTCTTTTCCCACCAAAAGAAGAGACACCCCGAATGCTTAAAGTTCTCCTAGGAAACACAGGAAA
G
GTGGACCTTGGAAGACTCCTTAAAGGAAAGAGAAAAACAACCACTCAGAAATAA


Translation (694 aa):
MLKSLTVKFNKVNPMEGRMEKKLCPNLSSLSQPTIAQGDNQSEKEPLRSRTPITFEKSHSKEDNSTGENS
L
RDFTPNPDPECRAELTRTMAEMEKTRTGKERPV
SFKTKVLETSIINEYTDAHLHNLVERMRERTALYKK
T
LTEEENFPEVEASSQT
AMSTNISPKQENNSKLKEHQDTFSFKPQRVPVKEHLRRMILPRSIDSYTDRVY
L
LWLLLVTIAYNWNCWLLPVRLVFPCQTPDNKNYWIITDIVCDIIYLCDILLIQPRLQFVRGGEII
VDSN
E
LKRNYRSSTKFR
MDVASLLPFEVLYIFFGVNPIFRANRILKYTSFFEFNHHLESIMDKAYVYRVIRTTG
Y
LLFLLHINACVYYWASDYEGIGSTKWVYNGEGN
KYLRCFYWAVRTLITIGGLPEPQTSFEIVFQFLNFF
S
GVFVFSSLIGQ
MRDVIGAATANQNYFQACMDHIIAYMNKYSIPQSVQYRVRTWLEYTWNSQRILDESNL
L
ENLPTAMQLSIALDINFSIIDKVELFK
GCDTQMIYDLLLRLKSTIYLPGDFVCKKGEIGKEMYIIKHGE
V
QVLGGPDGAQVLVTLKAGSVFGEI
SLLAKGGGNRRTADVVAHGFANLLTLDKKTLQEILLHYPTSKKLL
M
KKA
KILLSQKGKTTQAIPARPGPAFLFPPKEETPRMLKVLLGNTGKVDLGRLLKGKRKTTTQK



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser