NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18742.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18742.1 Public Mus musculus 4 Wasf2 19 105 81 CCDS HistoryNCBI Gene:242687Re-query CCDS DB by CCDS ID:18742.1See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18742.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000084241 ENSMUSP00000081263 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000084241Link to Ensembl Protein Viewer:ENSMUSP00000081263Re-query CCDS DB by Nucleotide ID:ENSMUST00000084241Re-query CCDS DB by Protein ID:ENSMUSP00000081263
Original member Current member EBI,WTSI ENSMUST00000105912 ENSMUSP00000101532 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105912Link to Ensembl Protein Viewer:ENSMUSP00000101532Re-query CCDS DB by Nucleotide ID:ENSMUST00000105912Re-query CCDS DB by Protein ID:ENSMUSP00000101532
Original member Current member EBI,WTSI OTTMUST00000024403 OTTMUSP00000011229 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024403Link to Vega Protein Viewer:OTTMUSP00000011229Re-query CCDS DB by Nucleotide ID:OTTMUST00000024403Re-query CCDS DB by Protein ID:OTTMUSP00000011229
Original member Current member EBI,WTSI OTTMUST00000024404 OTTMUSP00000011230 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024404Link to Vega Protein Viewer:OTTMUSP00000011230Re-query CCDS DB by Nucleotide ID:OTTMUST00000024404Re-query CCDS DB by Protein ID:OTTMUSP00000011230
Original member Current member NCBI NM_153423.6 NP_700472.1 Accepted alive Link to Nucleotide Sequence:NM_153423.6Link to Protein Sequence:NP_700472.1Re-query CCDS DB by Nucleotide ID:NM_153423Re-query CCDS DB by Protein ID:NP_700472Link to BLink:NP_700472.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_700472.1 497 Q8BH43 497 100% 0 0

Chromosomal Locations for CCDS 18742.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 133176483 133176612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 133184969 133185103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 133185599 133185752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 133189078 133189195 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 133190129 133190259 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 133192105 133192260 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 133194396 133194907 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 133195717 133195874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1494 nt):
ATGCCGTTAGTAACCAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGATACAAGCG
AG
CTGGAATGCAGGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTAAGTATGC
A
GAGGACATTTTCGGAGAGATTTGTACTCAGGCAAGTGCCTTTGCCTCCCGAGTAAACTCCCTTGCTGAG
CGG
GTTGACCGAGTACAAGTTAAAGTCACTCAGCTGGATCCCAAGGAAGAAGAAGTGTCACTACAAGGAA
TC
AACACTCGGAAGGCCTTCAGAAGTTCTACCACCCAAGACCAGAAGCTCTTTGACAGGAACTCTCTCCC
G
GTGCCCGTCTTAGAGACCTATAACAGCTGTGACGCTCCTCCCCCTCTTAACAATCTCAGTCCTTACAGG
GAC
GATGGAAAAGAGGCACTCAAATTCTACACCAACCCCTCATACTTCTTTGATCTTTGGAAGGAGAAGA
TG
CTGCAGGACACCAAGGATATCATGAAAGAGAAGAGAAAGCATAGGAAAGAAAAGAAAGATAATCCAAA
T
AGAGGGAATGTGAACCCACGTAAAATCAAGACACGCAAGGAAGAGTGGGAGAAGATGAAAATGGGACAA
GAA
TTTGTAGAGTCCAAGGAGAGGCTGGGGCCTTCTGGGTATTCGTCCACCTTGGTGTACCAGAATGGCA
GC
ATTGGCTCTGTTGAAAATGTGGATGCGGCCAGCTACCCACCACCACCACAGTCGGACTCTGCCTCCTC
A
CCTTCCCCTTCATTCTCTGAAGACAACTTGCCTCCCCCGCCAGCAGAATTCAGCTACCCTGCAGACAAC
CAA
AGAGGATCTGTCTTGGCTGGACCCAAAAGAACCAGCATGGTCAGCCCAAGCCATCCACCCCCAGCTC
CT
CCTCTGAGCTCTCCGCCAGGTCCCAAGCCTGGCTTCGCTCCTCCACCTGCCCCTCCACCTCCACCTCC
C
ATGAGTGTGCCACCTCCACTACCATCGATGGGATTCGGGTCTCCTGGGACCCCTCCACCCCCATCACCT
CCA
TCTTTCCCTCCTCACCCTGATTTTGCTGCTCCTCCACCACCTCCCCCACCACCAGCAGCTGACTACC
CA
ATGCCACCACCTCCTTTGTCCCAACCGTCTGGAGGTGCTCCTCCGCCTCCTCCTCCCCCTCCCCCTCC
A
GGGCCCCCGCCTCTCCCCTTCAGCGGTGCTGATGGCCAGCCTGCTGCACCACCACCACCACCACCTTCT
GAG
GCCACCAAGCCCAAGTCTTCATTGCCTGCTGTGAGTGACGCGCGCAGTGACCTGCTTTCTGCCATTC
GC
CAAGGCTTTCAGCTGCGAAGGGTTGAAGAGCAACGGGAGCAAGAGAAGCGTGATGTGGTGGGCAATGA
T
GTGGCCACCATCCTGTCCCGTCGGATCGCTGTTGAGTACAGCGACTCGGAAGATGATTCTTCTGAATTT
GAT
GAAGACGACTGGTCGGATTAA


Translation (497 aa):
MPLVTRNIEPRHLCRQTLPSDTSELECRTNITLANVIRQLGSLSKYAEDIFGEICTQASAFASRVNSLAE
R
VDRVQVKVTQLDPKEEE
VSLQGINTRKAFRSSTTQDQKLFDRNSLPVPVLETYNSCDAPPPLNNLSPYR
D
DGKEALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHR
KEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQ
E
FVESKERLGPS
GYSSTLVYQNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADN
Q
RGSVLAGPKRTSMVSPSHPPPAPPLSSPPGPKPGFAPPPAPPPPPPMSVPPPLPSMGFGSPGTPPPPSP
P
SFPPHPDFAAPPPPPPPPAADYPMPPPPLSQPSGGAPPPPPPPPPPGPPPLPFSGADGQPAAPPPPPPS
E
ATKPKSSLPAVSDARSDLLSAIRQ
GFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEF
D
EDDWSD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser