NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29202.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29202.1 Public Mus musculus 18 Spry4 16 104 75 CCDS HistoryNCBI Gene:24066Re-query CCDS DB by CCDS ID:29202.1See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29202.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000025295 ENSMUSP00000025295 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025295Link to Ensembl Protein Viewer:ENSMUSP00000025295Re-query CCDS DB by Nucleotide ID:ENSMUST00000025295Re-query CCDS DB by Protein ID:ENSMUSP00000025295
Original member Current member NCBI NM_011898.2 NP_036028.2 Accepted alive Link to Nucleotide Sequence:NM_011898.2Link to Protein Sequence:NP_036028.2Re-query CCDS DB by Nucleotide ID:NM_011898Re-query CCDS DB by Protein ID:NP_036028Link to BLink:NP_036028.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036028.2 300 Q9WTP2 300 100% 0 0

Chromosomal Locations for CCDS 29202.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 38589806 38590708 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (903 nt):
ATGGAGCCCCCGGTTCCACAGAGCAGCGTCCCTGTGAATCCCAGCTCAGTCATGGTGCAGCCCCTCCTTG
AC
AGCAGAGCGCCCCACAGCCGGCTCCAGCACCCACTCACCATCTTACCCATTGACCAGATGAAGACCAG
C
CACGTGGAGAATGACTACATAGACAACCCTAGCCTGGCCCCTGCCACGGGTCCCAAGCGGCCCCGGGGC
GGG
CCACCAGAGCTGGCTCCTACACCTGCCCGCTGTGACCAGGATATTACTCACCACTGGATCTCCTTCA
GC
GGTCGGCCCAGCTCTGTAAGCAGCAGTAGCAGCACTTCCTCCGACCAGAGGCTCCTAGATCACATGGC
T
CCACCGCCCGTGGCTGAGCAGGCCTCACCCAGGGCTGTGCGCCTCCAGCCCAAGGTGGTTCACTGTAAG
CCG
CTGGACCTCAAAGGCCCGACAGCTCCGCCAGAGCTAGACAAGCACTTCTTGCTGTGTGAGGCCTGTG
GA
AAGTGTAAGTGCAAAGAGTGTGCGTCCCCTCGGACGTTACCTTCCTGCTGGGTCTGCAACCAGGAGTG
C
CTGTGCTCGGCTCAGACGCTGGTCAACTATGGCACATGCATGTGTCTGGTGCAAGGTATCTTCTATCAC
TGT
ACTAATGAGGATGATGAGGGCTCTTGCGCCGACCACCCCTGCTCCTGTTCCGGCTCCAACTGCTGCG
CC
CGCTGGTCCTTCATGGGCGCCCTCTCTGTGGTGCTGCCCTGTCTGCTGTGCTACCTGCCGGCCACAGG
C
TGCGTCAAGCTGGCCCAGCGAGGCTACGACCGCCTGAGACGCCCCGGTTGCCGCTGCAAGCACACGAAC
AGC
GTCATCTGCAAGGCAGCCAGTGGGGACACCAAGACCAGCAGGTCTGACAAGCCTTTCTGA


Translation (300 aa):
MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMKTSHVENDYIDNPSLAPATGPKRPRG
G
PPELAPTPARCDQDITHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCK
P
LDLKGPTAPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYH
C
TNEDDEGSCADHPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTN
S
VICKAASGDTKTSRSDKPF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser