NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22310.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22310.1 Public Mus musculus 8 Gpm6a 16 104 75 CCDS HistoryNCBI Gene:234267Re-query CCDS DB by CCDS ID:22310.1See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22310.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033915 ENSMUSP00000033915 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033915Link to Ensembl Protein Viewer:ENSMUSP00000033915Re-query CCDS DB by Nucleotide ID:ENSMUST00000033915Re-query CCDS DB by Protein ID:ENSMUSP00000033915
Original member Current member NCBI NM_153581.6 NP_705809.1 Accepted alive Link to Nucleotide Sequence:NM_153581.6Link to Protein Sequence:NP_705809.1Re-query CCDS DB by Nucleotide ID:NM_153581Re-query CCDS DB by Protein ID:NP_705809Link to BLink:NP_705809.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_705809.1 278 P35802 278 100% 0 0

Chromosomal Locations for CCDS 22310.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 54955279 54955315 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 55037328 55037520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 55047235 55047391 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 55050105 55050258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 55054772 55054848 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 55055376 55055441 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 55058777 55058929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (837 nt):
ATGGAAGAGAATATGGAAGAAGGACAGACACAGAAAGGGTGCTTCGAGTGCTGCATTAAATGCCTGGGAG
GT
ATTCCCTATGCTTCTCTGATTGCAACCATCCTGCTGTATGCAGGCGTTGCCCTGTTCTGTGGCTGTGG
C
CATGAAGCCCTTTCTGGAACAGTCAACATTCTGCAGACCTACTTTGAGTTGGCAAGGACTGCTGGAGAC
ACA
CTGGATGTTTTCACTATGATTGACATCTTTAAGTATGTGATCTATGGCATTGCGGCTGCTTTCTTTG
TC
TATGGCATTTTACTGATGGTAGAAGGTTTCTTCACAACTGGGGCTATCAAAGATCTCTATGGAGACTT
C
AAAATCACCACCTGTGGCAGATGTGTGAGCGCTTGGTTTATCATGCTGACATACCTCTTCATGTTGGCC
TGG
CTGGGAGTCACAGCTTTCACCTCACTGCCCGTGTACATGTATTTCAATGTGTGGACCATCTGCCGGA
AC
ACCACTCTAGTGGAGGGAGCAAATCTCTGCTTGGATCTGCGTCAGTTTGGGATTGTGACAATTGGAGA
G
GAAAAGAAAATTTGTACTGCCTCTGAGAACTTCCTGAGGATGTGTGAATCTACTGAGCTGAATATGACC
TTC
CACTTGTTCATTGTGGCACTTGCTGGAGCTGGAGCAGCAGTTATTGCTATGGTCCACTACCTGATGG
TT
CTGTCTGCCAACTGGGCCTATGTGAAAGATGCCTGCCGCATGCAGAAGTACGAAGACATCAAGTCAAA
G
GAAGAGCAGGAGCTGCACGACATCCATTCTACTCGCTCCAAAGAGCGGCTCAATGCGTACACATAA


Translation (278 aa):
MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFELARTAGD
T
LDVFT
MIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLA
W
LGVTAFTSLPVYMYFNVWTICRNTTLVEGANLCLDLRQF
GIVTIGEEKKICTASENFLRMCESTELNMT
F
HLFIVALAGAGAAVIAM
VHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser