NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37395.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37395.1 Public Mus musculus 16 Sod1 16 104 75 CCDS HistoryNCBI Gene:20655Re-query CCDS DB by CCDS ID:37395.1See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 37395.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023707 ENSMUSP00000023707 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023707Link to Ensembl Protein Viewer:ENSMUSP00000023707Re-query CCDS DB by Nucleotide ID:ENSMUST00000023707Re-query CCDS DB by Protein ID:ENSMUSP00000023707
Original member Current member NCBI NM_011434.1 NP_035564.1 Accepted alive Link to Nucleotide Sequence:NM_011434.1Link to Protein Sequence:NP_035564.1Re-query CCDS DB by Nucleotide ID:NM_011434Re-query CCDS DB by Protein ID:NP_035564Link to BLink:NP_035564.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035564.1 154 P08228 154 100% 0 0

Chromosomal Locations for CCDS 37395.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 90220858 90220929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90222780 90222876 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90224356 90224425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90225145 90225262 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90226150 90226257 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (465 nt):
ATGGCGATGAAAGCGGTGTGCGTGCTGAAGGGCGACGGTCCGGTGCAGGGAACCATCCACTTCGAGCAGA
AG
GCAAGCGGTGAACCAGTTGTGTTGTCAGGACAAATTACAGGATTAACTGAAGGCCAGCATGGGTTCCA
C
GTCCATCAGTATGGGGACAATACACAAGGCTGTACCAGTGCAGGACCTCATTTTAATCCTCACTCTAAG
AAA
CATGGTGGCCCGGCGGATGAAGAGAGGCATGTTGGAGACCTGGGCAATGTGACTGCTGGAAAGGACG
GT
GTGGCCAATGTGTCCATTGAAGATCGTGTGATCTCACTCTCAGGAGAGCATTCCATCATTGGCCGTAC
A
ATGGTGGTCCATGAGAAACAAGATGACTTGGGCAAAGGTGGAAATGAAGAAAGTACAAAGACTGGAAAT
GCT
GGGAGCCGCTTGGCCTGTGGAGTGATTGGGATTGCGCAGTAA


Translation (154 aa):
MAMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSK
K
HGGPADEE
RHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGN
A
GSRLACGVIGIAQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser