NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19889.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19889.1 Public Mus musculus 5 Kl 16 104 75 CCDS HistoryNCBI Gene:16591Re-query CCDS DB by CCDS ID:19889.1

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19889.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000078856 ENSMUSP00000077899 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000078856Link to Ensembl Protein Viewer:ENSMUSP00000077899Re-query CCDS DB by Nucleotide ID:ENSMUST00000078856Re-query CCDS DB by Protein ID:ENSMUSP00000077899
Original member Current member NCBI NM_013823.2 NP_038851.2 Accepted alive Link to Nucleotide Sequence:NM_013823.2Link to Protein Sequence:NP_038851.2Re-query CCDS DB by Nucleotide ID:NM_013823Re-query CCDS DB by Protein ID:NP_038851Link to BLink:NP_038851.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038851.2 1014 O35082-1 1014 100% 0 0

Chromosomal Locations for CCDS 19889.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

Chromosome Start Stop Links
5 150952717 150953541 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 150980610 150981120 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 150982503 150982771 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 150988393 150989494 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 150991517 150991854 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3045 nt):
ATGCTAGCCCGCGCCCCTCCTCGCCGCCCGCCGCGGCTGGTGCTGCTCCGTTTGCTGTTGCTGCATCTGC
TG
CTGCTCGCCCTGCGCGCCCGCTGCCTGAGCGCTGAGCCGGGTCAGGGCGCGCAGACCTGGGCTCGCTT
C
GCGCGCGCTCCTGCCCCAGAGGCCGCTGGCCTCCTCCACGACACCTTCCCCGACGGTTTCCTCTGGGCG
GTA
GGCAGCGCCGCCTATCAGACCGAGGGCGGCTGGCGACAGCACGGCAAAGGCGCGTCCATCTGGGACA
CT
TTCACCCATCACTCTGGGGCGGCCCCGTCCGACTCCCCGATCGTCGTGGCGCCGTCGGGTGCCCCGTC
G
CCTCCCCTGTCCTCCACTGGAGATGTGGCCAGCGATAGTTACAACAACGTCTACCGCGACACAGAGGGG
CTG
CGCGAACTGGGGGTCACCCACTACCGCTTCTCCATATCGTGGGCGCGGGTGCTCCCCAATGGCACCG
CG
GGCACTCCCAACCGCGAGGGGCTGCGCTACTACCGGCGGCTGCTGGAGCGGCTGCGGGAGCTGGGCGT
G
CAGCCGGTGGTTACCCTGTACCATTGGGACCTGCCACAGCGCCTGCAGGACACCTATGGCGGATGGGCC
AAT
CGCGCCCTGGCCGACCATTTCAGGGATTATGCCGAGCTCTGCTTCCGCCACTTCGGTGGTCAGGTCA
AG
TACTGGATCACCATTGACAACCCCTACGTGGTGGCCTGGCACGGGTATGCCACCGGGCGCCTGGCCCC
G
GGCGTGAGGGGCAGCTCCAGGCTCGGGTACCTGGTTGCCCACAACCTACTTTTGGCTCATGCCAAAGTC
TGG
CATCTCTACAACACCTCTTTCCGCCCCACACAGGGAGGCCGGGTGTCTATCGCCTTAAGCTCCCATT
GG
ATCAATCCTCGAAGAATGACTGACTATAATATCAGAGAATGCCAGAAGTCTCTTGACTTTGTGCTAGG
C
TGGTTTGCCAAACCCATATTTATTGATGGCGACTACCCAGAGAGTATGAAGAACAACCTCTCGTCTCTT
CTG
CCTGATTTTACTGAATCTGAGAAGAGGCTCATCAGAGGAACTGCTGACTTTTTTGCTCTCTCCTTCG
GA
CCAACCTTGAGCTTTCAGCTATTGGACCCTAACATGAAGTTCCGCCAATTGGAGTCTCCCAACCTGAG
G
CAGCTTCTGTCTTGGATAGATCTGGAATATAACCACCCTCCAATATTTATTGTGGAAAATGGCTGGTTT
GTC
TCGGGAACCACCAAAAGGGATGATGCCAAATATATGTATTATCTCAAGAAGTTCATAATGGAAACCT
TA
AAAGCAATCAGACTGGATGGGGTCGACGTCATTGGGTACACCGCGTGGTCGCTCATGGACGGTTTCGA
G
TGGCATAGGGGCTACAGCATCCGGCGAGGACTCTTCTACGTTGACTTTCTGAGTCAGGACAAGGAGCTG
TTG
CCAAAGTCTTCGGCCTTGTTCTACCAAAAGCTGATAGAGGACAATGGCTTTCCTCCTTTACCTGAAA
AC
CAGCCCCTTGAAGGGACATTTCCCTGTGACTTTGCTTGGGGAGTTGTTGACAACTACGTTCAAGTGGA
C
ACTACTCTCTCTCAGTTTACTGACCCGAATGTCTATCTGTGGGATGTGCATCACAGTAAGAGGCTTATT
AAA
GTAGACGGGGTTGTAGCCAAGAAGAGAAAACCTTACTGTGTTGATTTCTCTGCCATCCGGCCTCAGA
TA
ACCTTACTTCGAGAAATGCGGGTCACCCACTTTCGCTTCTCCCTGGACTGGGCCCTGATCTTGCCTCT
G
GGTAACCAGACCCAAGTGAACCACACGGTTCTGCACTTCTACCGCTGCATGATCAGCGAGCTGGTGCAC
GCC
AACATCACTCCAGTGGTGGCCCTGTGGCAGCCAGCAGCCCCGCACCAAGGCCTGCCACATGCCCTTG
CA
AAACATGGGGCCTGGGAGAACCCGCACACTGCTCTGGCGTTTGCAGACTACGCAAACCTGTGTTTTAA
A
GAGTTGGGTCACTGGGTCAATCTCTGGATCACCATGAACGAGCCAAACACACGGAACATGACCTATCGT
GCC
GGGCACCACCTCCTGAGAGCCCATGCCTTGGCTTGGCATCTGTACGATGACAAGTTTAGGGCGGCTC
AG
AAAGGCAAAATATCCATCGCCTTGCAGGCTGACTGGATAGAACCGGCCTGCCCTTTCTCTCAAAATGA
C
AAAGAAGTGGCCGAGAGAGTTTTGGAATTTGATATAGGCTGGCTGGCAGAGCCTATTTTTGGTTCCGGA
GAT
TATCCACGTGTGATGAGGGACTGGCTGAACCAAAAAAACAATTTTCTTTTGCCCTATTTCACCGAAG
AT
GAAAAAAAGCTAGTCCGGGGTTCCTTTGACTTCCTGGCGGTGAGTCATTACACCACCATTCTGGTAGA
C
TGGGAAAAGGAGGATCCGATGAAATACAACGATTACTTGGAGGTACAGGAGATGACTGACATCACATGG
CTC
AACTCTCCCAGTCAGGTGGCAGTGGTGCCTTGGGGGCTGCGCAAAGTGCTCAACTGGCTAAGGTTCA
AG
TACGGAGACCTCCCGATGTATGTGACAGCCAATGGAATCGATGATGACCCCCACGCCGAGCAAGACTC
A
CTGAGGATCTATTATATTAAGAATTATGTGAATGAGGCTCTGAAAGCCTACGTGTTGGACGACATCAAC
CTT
TGTGGCTACTTTGCGTATTCACTTAGTGATCGCTCAGCTCCCAAGTCTGGCTTTTATCGATATGCTG
CG
AATCAGTTTGAGCCCAAACCATCTATGAAACATTACAGGAAAATTATTGACAGCAATGGCTTCCTGGG
T
TCTGGAACACTGGGAAGGTTTTGTCCAGAAGAATACACTGTGTGCACCGAATGTGGATTTTTTCAAACC
CGG
AAGTCTTTGCTGGTCTTCATCTCGTTTCTTGTTTTTACTTTTATTATTTCTCTTGCTCTCATTTTTC
AC
TACTCCAAGAAAGGCCAGAGAAGTTATAAGTAA


Translation (1014 aa):
MLARAPPRRPPRLVLLRLLLLHLLLLALRARCLSAEPGQGAQTWARFARAPAPEAAGLLHDTFPDGFLWA
V
GSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPSDSPIVVAPSGAPSPPLSSTGDVASDSYNNVYRDTEG
L
RELGVTHYRFSISWARVLPNGTAGTPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDTYGGWA
N
RALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLL
AHAKV
W
HLYNTSFRPTQGGRVSIALSSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYPESMKNNLSSL
L
PDFTESEKRLIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQLLSWIDLEYNHPPIFIVENGWF
V
SGTTKRDDAKYMYYLKKFIMETLK
AIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKEL
L
PKSSALFYQKLIEDNGFPPLPENQPLEGTFPCDFAWGVVDNYVQ
VDTTLSQFTDPNVYLWDVHHSKRLI
K
VDGVVAKKRKPYCVDFSAIRPQITLLREMRVTHFRFSLDWALILPLGNQTQVNHTVLHFYRCMISELVH
A
NITPVVALWQPAAPHQGLPHALAKHGAWENPHTALAFADYANLCFKELGHWVNLWITMNEPNTRNMTYR
A
GHHLLRAHALAWHLYDDKFRAAQKGKISIALQADWIEPACPFSQNDKEVAERVLEFDIGWLAEPIFGSG
D
YPRVMRDWLNQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYTTILVDWEKEDPMKYNDYLEVQEMTDITW
L
NSPSQVAVVPWGLRKVLNWLRFKYGDLPMYVTANGIDDDPHAEQDSLRIYYIKNYVNEALK
AYVLDDIN
L
CGYFAYSLSDRSAPKSGFYRYAANQFEPKPSMKHYRKIIDSNGFLGSGTLGRFCPEEYTVCTECGFFQT
R
KSLLVFISFLVFTFIISLALIFHYSKKGQRSYK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser