NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28327.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28327.1 Public Mus musculus 16 Ifngr2 16 104 75 CCDS HistoryNCBI Gene:15980Re-query CCDS DB by CCDS ID:28327.1See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28327.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023687 ENSMUSP00000023687 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023687Link to Ensembl Protein Viewer:ENSMUSP00000023687Re-query CCDS DB by Nucleotide ID:ENSMUST00000023687Re-query CCDS DB by Protein ID:ENSMUSP00000023687
Original member Current member EBI,WTSI OTTMUST00000070230 OTTMUSP00000035758 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000070230Link to Vega Protein Viewer:OTTMUSP00000035758Re-query CCDS DB by Nucleotide ID:OTTMUST00000070230Re-query CCDS DB by Protein ID:OTTMUSP00000035758
Original member Current member NCBI NM_008338.3 NP_032364.1 Accepted alive Link to Nucleotide Sequence:NM_008338.3Link to Protein Sequence:NP_032364.1Re-query CCDS DB by Nucleotide ID:NM_008338Re-query CCDS DB by Protein ID:NP_032364Link to BLink:NP_032364.1

Chromosomal Locations for CCDS 28327.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 91547163 91547232 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91554948 91555080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91557885 91558078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91559977 91560125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91560545 91560704 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91561620 91561777 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91562871 91563005 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (999 nt):
ATGCGGCCTTTGCCACTGTGGCTGCCGTCGCTGCTGCTCTGTGGGCTCGGTGCCGCGGCGTCCTCGCCAG
AC
TCGTTTTCCCAGCTTGCGGCCCCTCTGAACCCAAGGCTTCACCTGTACAATGATGAGCAGATTCTAAC
T
TGGGAGCCGTCACCTTCCAGCAATGACCCAAGACCAGTGGTCTACCAGGTGGAATATAGCTTCATCGAT
GGC
TCTTGGCATAGGTTGCTGGAGCCGAACTGTACGGACATCACAGAGACAAAGTGTGACTTAACAGGAG
GC
GGCCGCTTGAAGCTTTTCCCACACCCATTCACAGTCTTCCTGCGGGTGCGAGCCAAGCGAGGGAACCT
C
ACTTCCAAGTGGGTGGGGCTGGAGCCATTTCAACACTATGAGAATGTTACTGTTGGACCTCCGAAAAAC
ATC
TCGGTGACCCCAGGAAAAGGTTCCCTCGTCATACACTTCTCCCCTCCCTTTGATGTGTTCCACGGGG
CA
ACTTTTCAGTATCTTGTCCACTACTGGGAAAAGTCAGAAACCCAACAGGAACAGGTTGAAGGCCCTTT
C
AAGAGCAACTCCATTGTGCTGGGCAATCTGAAGCCATACAGAGTATATTGTTTACAAACTGAGGCACAA
CTG
ATTTTGAAAAACAAAAAAATCCGACCACATGGGCTCTTGAGCAATGTATCCTGTCACGAAACAACAG
CA
AATGCCTCCGCCAGGCTGCAGCAAGTCATCCTGATTCCGTTGGGCATCTTCGCATTGCTGCTCGGCCT
G
ACGGGCGCCTGCTTCACCCTGTTCCTCAAATACCAAAGCCGAGTGAAGTACTGGTTTCAGGCTCCGCCA
AAC
ATCCCGGAACAAATCGAAGAGTATCTAAAGGACCCAGACCAATTCATCTTAGAGGTCTTGGACAAGG
AC
GGTTCACCGAAGGAGGACTCCTGGGACTCCGTGTCAATTATTTCTTCTCCAGAAAAGGAGCGAGATGA
T
GTGCTCCAAACACCGTGA


Translation (332 aa):
MRPLPLWLPSLLLCGLGAAASSPDSFSQLAAPLNPRLHLYNDEQILTWEPSPSSNDPRPVVYQVEYSFID
G
SWHRLLEPNCTDITETKCDLTGGGRLKLFPHPFTVFLRVRAKRGNLTSKWVGLEPFQHYEN
VTVGPPKN
I
SVTPGKGSLVIHFSPPFDVFHGATFQYLVHYWEKSETQQEQ
VEGPFKSNSIVLGNLKPYRVYCLQTEAQ
L
ILKNKKIRPHGLLSNVSCHETTAN
ASARLQQVILIPLGIFALLLGLTGACFTLFLKYQSRVKYWFQAPP
N
IPEQIEE
YLKDPDQFILEVLDKDGSPKEDSWDSVSIISSPEKERDDVLQTP



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser