NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25665.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25665.1 Public Mus musculus 11 Foxj1 16 104 75 CCDS HistoryNCBI Gene:15223Re-query CCDS DB by CCDS ID:25665.1See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25665.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000036215 ENSMUSP00000038351 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000036215Link to Ensembl Protein Viewer:ENSMUSP00000038351Re-query CCDS DB by Nucleotide ID:ENSMUST00000036215Re-query CCDS DB by Protein ID:ENSMUSP00000038351
Original member Current member EBI,WTSI OTTMUST00000008445 OTTMUSP00000004095 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000008445Link to Vega Protein Viewer:OTTMUSP00000004095Re-query CCDS DB by Nucleotide ID:OTTMUST00000008445Re-query CCDS DB by Protein ID:OTTMUSP00000004095
Original member Current member NCBI NM_008240.3 NP_032266.3 Accepted alive Link to Nucleotide Sequence:NM_008240.3Link to Protein Sequence:NP_032266.3Re-query CCDS DB by Nucleotide ID:NM_008240Re-query CCDS DB by Protein ID:NP_032266Link to BLink:NP_032266.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032266.3 421 Q61660 421 100% 0 0

Chromosomal Locations for CCDS 25665.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 116331710 116332477 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116334042 116334539 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1266 nt):
ATGGCGGAGAGCTGGCTGCGCCTCTGCGGAGCGGGTCCCGGAGAGGAAGCCGGGCCGGAGGGCGGCATGG
AG
GAGCCGGACGCCCTGGATGACAGCCTGACCAGCCTGCAATGGCTGCAGGAATTCTCCATTCTCAACGC
C
AAGGCTCCCACTCTTCCCCCAGGAGGCACAGACCCCCACGGCTACCACCAAGTGCCGGGCTTGGTGGCG
CCC
GGGTCACCGCTGGCGGCAGACCCTGCCTGCCTTGGGCAGCCGCACACACCCGGCAAGCCCACATCGT
CG
TGCACATCTCGAAGCGCGCCCCCGGGGCTGCAGGCCCCGCCCCCTGACGACGTGGACTATGCCACCAA
C
CCACACGTGAAGCCACCCTACTCCTATGCCACTCTCATCTGCATGGCCATGCAAGCCAGCAAGGCCACC
AAG
ATCACTCTGTCGGCCATCTACAAGTGGATCACGGACAACTTCTGCTACTTCCGCCATGCAGACCCCA
CC
TGGCAGAATTCCATCCGCCACAACCTGTCCTTGAACAAGTGCTTCATCAAAGTGCCTCGGGAGAAGGA
T
GAGCCCGGCAAGGGGGGTTTCTGGCGCATCGACCCCCAGTACGCAGAGCGCCTGCTCAGTGGGGCCTTC
AAG
AAGCGGAGGCTGCCCCCAGTCCACATCCACCCTGCCTTTGCCCGCCAGGCCTCCCAGGAACCTAGCG
CT
GCCCCCTGGGGTGGGCCTCTGACCGTGAACAGGGAGGCCCAGCAGCTGCTTCAGGAGTTTGAGGAGGC
C
ACAGGGGAGGGGGGCTGGGGCACAGGAGAGGGCAGGCTGGGGCATAAGCGAAAGCAGCCGCTGCCCAAG
AGG
GTGGCCAAGGTCCTGCGGCCTCCCAGCACCTTACTGCTGACCCAGGAGGAGCAGGGTGAGCTGGAAC
CA
CTCAAAGGTAACTTTGACTGGGAGGCCATCTTTGAGGCTGGCGCACTGGGGGAGGAGCTGAGCTCACT
G
GAGGGTCTGGAGCTAAGCCCCCCGCTAAGCCCCAGCTCACATGGAGATGTGGATCTTACAGTCCATGGC
CGG
CACATCAACTGCCCTGCTACCTGGGGACCTCCAGCGGAGCAGGCTGCTGACAGCCTGGACTTTGATG
AG
ACCTTCTTGGCCACATCCTTCCTACAGCATCCCTGGGATGAGAGTGGTAGTGGCTGCCTGCCCCCAGA
A
CCCATCTTTGAAGCAGGGGATGCCACCCTGGCCGCTGACCTGCAGGACTGGGCCAGTGTGGGTGCCTTC
TTG
TAA


Translation (421 aa):
MAESWLRLCGAGPGEEAGPEGGMEEPDALDDSLTSLQWLQEFSILNAKAPTLPPGGTDPHGYHQVPGLVA
P
GSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKAT
K
ITLSAIYKWITDNFCYFRHADPTWQ
NSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAF
K
KRRLPPVHIHPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRLGHKRKQPLPK
R
VAKVLRPPSTLLLTQEEQGELEPLKGNFDWEAIFEAGALGEELSSLEGLELSPPLSPSSHGDVDLTVHG
R
HINCPATWGPPAEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPIFEAGDATLAADLQDWASVGAF
L




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser