NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30187.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30187.1 Public Mus musculus X Gabra3 16 104 75 CCDS HistoryNCBI Gene:14396Re-query CCDS DB by CCDS ID:30187.1See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 30187.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000055966 ENSMUSP00000062638 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055966Link to Ensembl Protein Viewer:ENSMUSP00000062638Re-query CCDS DB by Nucleotide ID:ENSMUST00000055966Re-query CCDS DB by Protein ID:ENSMUSP00000062638
Original member Current member EBI,WTSI OTTMUST00000043200 OTTMUSP00000019432 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043200Link to Vega Protein Viewer:OTTMUSP00000019432Re-query CCDS DB by Nucleotide ID:OTTMUST00000043200Re-query CCDS DB by Protein ID:OTTMUSP00000019432
Original member Current member NCBI NM_008067.4 NP_032093.3 Accepted alive Link to Nucleotide Sequence:NM_008067.4Link to Protein Sequence:NP_032093.3Re-query CCDS DB by Nucleotide ID:NM_008067Re-query CCDS DB by Protein ID:NP_032093Link to BLink:NP_032093.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032093.3 492 P26049 492 100% 0 0

Chromosomal Locations for CCDS 30187.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 72434649 72434984 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72445175 72445386 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72451504 72451656 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72459589 72459732 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72476226 72476308 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72501079 72501299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72511305 72511372 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72540063 72540184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72552677 72552816 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1479 nt):
ATGATAATCACACAAATGTGGCACTTTTATGTGACCAGAGTTGTACTTCTTCTCCTGATTAGTATTCTCC
CT
GGAACCACTAGCCAAGGGGAATCAAGACGACAAGAACCTGGGGACTTTGTGAAACAAGATATTGGAGG
A
CTCTCTCCCAAGCATGCCCCAGATATTCCTGACGATAGTACAGATAATATCACTATCTTCACTAGAATC
TTG
GATCGGCTTTTGGATGGCTATGATAACCGGCTTCGACCTGGACTTGGAGATGCAGTGACTGAAGTGA
AG
ACAGACATCTATGTGACCAGTTTTGGCCCTGTGTCAGACACTGATATGGAATATACTATTGATGTATT
T
TTTAGACAGACATGGCATGATGAAAGACTGAAATTTGATGGACCAATGAAGATCCTTCCACTGAACAAT
CTT
CTGGCTAGTAAGATATGGACTCCTGATACCTTCTTCCACAATGGTAAAAAATCAGTGGCTCACAATA
TG
ACCACACCCAACAAGCTGCTCAGACTGGTAGATAATGGGACCCTCCTCTATACAATGAGGTTAACAAT
A
CACGCTGAATGCCCCATGCATTTGGAAGATTTCCCCATGGATGTGCATGCCTGCCCACTGAAGTTTGGA
AGC
TATGCCTATACCAAAGCTGAAGTAATTTATTCTTGGACTCTTGGGAAGAACAAATCTGTGGAAGTAG
CA
CAGGATGGCTCACGCCTGAATCAGTATGACTTGCTTGGCCATGTTGTTGGGACAGAGATAATCCGGTC
T
AGTACAGGAGAATATGTCGTCATGACAACCCACTTTCATCTGAAGAGAAAAATTGGCTACTTTGTCATC
CAG
ACCTACTTGCCATGTATCATGACTGTCATTCTGTCACAAGTGTCTTTCTGGCTTAATAGAGAATCTG
TC
CCTGCCCGCACAGTCTTTGGTGTCACCACTGTTCTCACCATGACCACCTTGAGTATCAGTGCCAGAAA
C
TCTTTACCTAAAGTGGCATACGCGACGGCCATGGACTGGTTCATAGCCGTCTGTTATGCCTTTGTATTT
TCT
GCACTGATTGAATTTGCTACTGTCAACTACTTCACCAAGCGGAGTTGGGCTTGGGAAGGCAAGAAGG
TA
CCAGAGGCCCTGGAGATGAAGAAGAAAACACCAGCAGCTCCAACAAAGAAAAACACCACCTTCAACAT
A
GTGGGTACCACCTATCCTATCAATCTGGCCAAGGATACTGAGTTCTCCACCATCTCCAAGTCTGCTGCT
GCT
CCCAGTGCTTCTTCAACTCCAACAGCGATTGCTTCACCCAAGGCTACTTATGTGCAAGACAGTCCTG
CT
GAGACCAAGACCTACAACAGTGTCAGCAAGGTTGACAAAATTTCCCGCATCATCTTCCCTGTGCTCTT
T
GCCATATTCAATCTTGTCTATTGGGCTACATATGTGAACCGGGAATCAGCTATCAAGGGCATGATCCGC
AAA
CAGTAG


Translation (492 aa):
MIITQMWHFYVTRVVLLLLISILPGTTSQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRI
L
DRLLDGYDNRLRPGLG
DAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNN
L
LASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTM
RLTIHAECPMHLEDFPMDVHACPLKFG
S
YAYTKAEVIYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVI
Q
TYLPCIMTVILSQVSFWLNRESVPARTVF
GVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVF
S
ALIEFATVNYFTKRSWAWEGKKVPEALEMK
KKTPAAPTKKNTTFNIVGTTYPINLAKDTEFSTISKSAA
A
PSASSTPTAIASPKATYVQDSPAETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVNRESAIKGMIR
K
Q




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser