NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35631.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35631.1 Public Mus musculus 1 Col4a3 16 104 75 CCDS HistoryNCBI Gene:12828Re-query CCDS DB by CCDS ID:35631.1See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 35631.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113457 ENSMUSP00000109084 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113457Link to Ensembl Protein Viewer:ENSMUSP00000109084Re-query CCDS DB by Nucleotide ID:ENSMUST00000113457Re-query CCDS DB by Protein ID:ENSMUSP00000109084
Original member Current member EBI,WTSI OTTMUST00000051474 OTTMUSP00000024235 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051474Link to Vega Protein Viewer:OTTMUSP00000024235Re-query CCDS DB by Nucleotide ID:OTTMUST00000051474Re-query CCDS DB by Protein ID:OTTMUSP00000024235
Original member Current member NCBI NM_007734.2 NP_031760.2 Accepted alive Link to Nucleotide Sequence:NM_007734.2Link to Protein Sequence:NP_031760.2Re-query CCDS DB by Nucleotide ID:NM_007734Re-query CCDS DB by Protein ID:NP_031760Link to BLink:NP_031760.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031760.2 1669 Q9QZS0 1669 100% 0 0

Chromosomal Locations for CCDS 35631.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 82587345 82587431 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82641439 82641495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82643209 82643298 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82648578 82648622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82649756 82649800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82650561 82650623 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82651254 82651307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82652161 82652187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82653301 82653378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82654954 82655016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82655126 82655161 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82656851 82656892 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82657146 82657223 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82660224 82660286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82660826 82660885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82662202 82662246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82662896 82662949 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82664577 82664618 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82666521 82666605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82666895 82666930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82668920 82669084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82669672 82669761 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82670175 82670270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82671307 82671377 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82672597 82672779 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82673979 82674147 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82675909 82676001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82676666 82676767 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82678567 82678664 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82679079 82679229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82679549 82679662 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82680680 82680847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82682286 82682375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82682703 82682837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82689107 82689205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82689986 82690075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82690521 82690660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82693419 82693545 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82696256 82696336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82696680 82696778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82697740 82697787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82700238 82700423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82700757 82700887 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82708590 82708662 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82710800 82710871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82710959 82711084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82711840 82711938 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82715242 82715454 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82716012 82716189 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82716298 82716412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82717833 82718005 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 82718800 82718884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5010 nt):
ATGCACTCCAAGACTGCTCCAAGGTTCCTGGTGTTCCTGCTGCTTACCCTGCTGCTACTCCTGGCTGCCT
CT
CCTGTGGCTAGCAAGGGCTGTGTCTGCAAAGGCAAAGGACAATGCCTCTGCGCGGGGACCAAAGGGGA
G
AAGGGGGAGAAAGGGGTTCCTGGTTCCCCTGGATTTCCTGGCCAGAAAGGATTTCCAGGTCCTGAAGGC
TTG
CCTGGACCACAGGGACCCAAGGGCTCCCCAGGACTTCCGGGACTCACTGGCCCCAAAGGCATCAGGG
GA
ATAACTGGATTACCAGGGTTTGCAGGTCCTCCTGGACTTCCAGGCCTCCCAGGCCACCCTGGGCCTCG
T
GGGCTGGCTGGTTTACCAGGATGCAACGGATCTAAGGGTGAACAAGGATTCCCGGGCTTTCCCGGCACA
CCA
GGCTATGCAGGGCTCCCAGGTCCTGATGGCTTGAAAGGACAAAAGGGTGAGCCTGCTCAAGGAGAAG
AC
AGGGGATTCAATGGAAAAGGTGACCCTGGGCCTCCAGGGGTTCCAGGCTTCCAGGGTTTTCCGGGACT
C
CCAGGTTTTCCAGGGCCTGCCGGTCCACCAGGACCTCCGGGATTTTTTGGTTTACCAGGAGCAATGGGA
CCC
AGAGGACCCAAAGGCCACATGGGCGATAGCGTGATAGGACAAAAAGGAGAAAGGGGTATGAAAGGAT
TA
ACAGGACCTCCTGGGCCACCAGGAACAGTGATTTTTACACTCACCCAGCCATACAACAAATCGGACTT
C
AAGGGAGAGAAAGGAGATGAGGGAGAGAGGGGTGAACCCGGACCTCCTGGACCCTCGGGGCCACCTGGA
GAC
TCCTATGGATCAGAAAAGGGTGCGCCTGGAGAGCCTGGTCCTCGGGGCAAACCTGGAAAAGATGGTG
CC
CCTGGCTTCCCTGGCACTGAGGGAGCCAAAGGCAACAGGGGCTTTCCTGGGTTGAGGGGTGAAGCTGG
C
ATTAAGGGAAGGAAAGGAGACATTGGCCCCCCAGGATTTCCTGGTCCAACAGAATATTATGACGCATAC
CTG
GAAAAGGGAGAGAGAGGAATGCCAGGCCTTCCTGGGCCCAAAGGAGCCCGTGGCCCACAGGGTCCAA
GT
GGTCCCCCTGGAGTCCCTGGAAGTCCTGGACTGTCAAGGCCTGGCCTCAGAGGACCCATTGGATGGCC
A
GGCTTGAAAGGGAGTAAAGGAGAGAGAGGACCCCCTGGAAAAGACACTGTGGGCCCTCCTGGACCCCTG
GGA
TGTCCTGGCTCACCAGGTCCACCAGGCCCTCCAGGACCTCCAGGATGTCCAGGTGACATTGTTTTTA
AA
TGTTCCCCTGGTGAGCATGGAATGCCAGGTGACACAGGACCTCCAGGAGTTCCAGGACTTGATGGACC
C
AAAGGAGAACCAGGCAGTCCATGCACCGAGTGTCACTGCTTCCCAGGGCCCCCTGGAGTCCCAGGATTT
CCA
GGATTAGATGGTATCAAAGGAATCCCAGGAGGACGAGGTGTGCCTGGTCTGAAGGGAAACCCAGGGT
CC
CCAGGAAGTGCAGGTCTCCCAGGATTTGCAGGATTCCCAGGTGACCAAGGGCATCCAGGACTTAAAGG
G
GACAAAGGGGATACACCTCTACCCTGGGGGCAAGTGGGTAATCCAGGTGATCCTGGACTCAGAGGCCTG
CCC
GGGAGAAAGGGCTTCGATGGAACTCCTGGAGGTCCAGGAGCGAAAGGACCACCAGGACCTCAGGGCG
AA
CCGGCCCTGAGTGGAAGGAAAGGGGACCAAGGACCTCCAGGACCTCCTGGATTCCCTGGACCCCCAGG
A
CCTGCAGGACCAGCTGGACCACCAGGCTATGGACCTCAAGGAGAGCCAGGTCCAAAGGGAGCCCAAGGA
GTC
CCCGGCGTCCTGGGACCACCTGGAGAAGCCGGTCTTAAAGGAGAACCCAGTACATCAACTCCAGATC
TA
GGTCCCCCAGGCCCTCCAGGGCCCCCTGGTCAGGCTGGCCCCAGAGGTCTACCTGGTTTGCCTGGACC
G
GTGGGAAAATGTGATCCTGGTCTTCCTGGACCTGATGGTGAGCCAGGAATTCCAGAAGCTGGATGCCCA
GGG
CCTCCAGGACCTAAGGGAAATCAAGGTTTCCCAGGGACAAAAGGATCACCTGGTTGTCCTGGGGAAA
TG
GGAAAGCCTGGCCGTCCTGGAGAACCAGGCATCCCAGGAGCCAAGGGAGAACCATCCGTAGGCAGGCC
T
GGGAAACCAGGGAAACCAGGCTTTCCAGGAGAAAGAGGCAATGCTGGGGAAAATGGAGATATTGGACTC
CCT
GGGCTTCCAGGCCTCCCTGGAACTCCAGGAAGAGGCGGGCTTGACGGGCCTCCAGGAGACCCAGGAC
AG
CCTGGATCACCTGGAGCAAAAGGATCCCCAGGAAGGTGCATACCAGGACCCAGGGGCACCCAAGGACT
T
CCCGGCTTGAATGGATTGAAAGGGCAACCAGGTCGAAGAGGTGATACCGGGCCAAAGGGAGACCCTGGC
ATC
CCAGGCATGGACAGGTCTGGGGTCCCCGGAGATCCTGGACCACCAGGAACACCAGGTTGTCCTGGTG
AG
ATGGGACCACCTGGACAAAAAGGATATCCGGGAGCTCCAGGATTCCCAGGACCACCAGGCGAGAAAGG
A
GAGGTTGGAATGATGGGCTATCCTGGAACCACTGGCCCTCCGGGGCTTCCTGGGAAACCAGGCTCACAG
GGG
CAGCGAGGTAGCCTCGGAATCCCAGGAATGAAAGGGGAAAAAGGACGCCCAGGAGCCAAAGGCGAAC
GA
GGAGAGAAAGGAAAACCAGGGCCTTCTCAAACAACACTCTTAAAGGGAGACAAAGGAGAGCCTGGACT
T
AAAGGATTTGTTGGGAATCCAGGTGAGAAAGGAAACAGAGGCAACCCAGGGTTACCAGGTCCGAAAGGC
CTC
GAGGGATTGCCTGGGCTACCAGGTCCTCCAGGCCCTAGAGGAGATACGGGAAGCAGAGGAAATCCTG
GA
AGACCAGGACCACACGGCATGCCAGGAAGCATGGGGATCATGGGGGTGCCAGGCCCTAAAGGGAGAAA
A
GGAACTTCAGGGCTTCCAGGTCTAGCTGGAAGACCAGGCCTGACAGGGATCCATGGTCCCCAAGGAGAT
AAG
GGGGAGCCGGGTTATTCAGAAGGTGCAAGACCAGGACCACCAGGACCAAAGGGCGATCCAGGATTGC
CA
GGTGACAAAGGAAAGAAAGGAGAAAGAGGCGTACCTGGGCCACCTGGACAATCGGGGCCTGCCGGACC
T
GATGGAGCCCCTGGGAGTCCTGGGAGTCCTGGTCACCCAGGAAAACCAGGTCCTGCTGGTGATTTGGGT
CTG
AAAGGACAGAAAGGCTTCCCAGGCCCTCCAGGAAGCACTGGCCCTCCAGGCCCTCCAGGACTCCCAG
GA
CTTCCTGGGCCAATGGGTATGAGAGGTGACCAAGGACGTGATGGAATTCCTGGTCCTCCAGGAGAAAA
A
GGAGAAACAGGCTTGCTGGGGGCCTACCCAGGCCCAAAAGGGAGCCCTGGTGTACCAGGTGCCAAAGGA
GAC
AGGGGAGTTCCAGGCTTGTCTGGCCTTCCCGGCAGGAAGGGGGTTATGGGGGATGTTGGACCCCAAG
GA
CCCCCAGGCACTGCTGGACTCCCAGGGCCACCAGGTCTACCTGGGGCAATTATCCCTGGCCCCAAAGG
A
GACAGAGGTCTTCCTGGCTTAAGAGGAAATCCAGGTGAGCCAGGTCCCCCTGGACCTCCAGGACCTATC
GGA
AAAGGCATAAAAGGTGACAAAGGATTTATGGGCCCACCTGGCCCCAAAGGCCTGCCTGGAACTGTAG
GG
GACATGGGCCCACCAGGTTTCCCGGGAGCACCAGGTACCCCCGGTCTTCCCGGTGTCAGAGGTGATCC
A
GGATTCCCTGGATTTCCAGGCATAAAAGGAGAAAAGGGTAACCCTGGATTTCTTGGGCCAATTGGACAT
CCA
GGACCAGTTGGGCCCAAAGGACCACCAGGTCCACGTGGAAAACCTGGCACTCTTAAGGTCATCTCTC
TT
CCGGGAAGCCCAGGGCCACCTGGTGTACCTGGACAGCCAGGAATGAAAGGAGACCCTGGACCCCTGGG
A
CTGCCAGGAATCCCAGGACCCTGTGGGCCAAGAGGTAAACCAGGCAAGGATGGGAAACCAGGAACTCCA
GGA
CCAGCTGGTACAAAGGGCAACAAGGGCTTGAAAGGACAGCAAGGCCCACCTGGTCTGGATGGATTGC
CA
GGCTTAAAGGGAAATCCTGGTGACAGGGGAACGCCGGCCACTGGTACAAGAATGCGAGGCTTCATCTT
C
ACCCGACACAGTCAAACCACGGCCATTCCTTCATGCCCTGAAGGAACACAGCCACTCTATAGTGGGTTT
TCT
CTTCTTTTTGTACAAGGAAACAAACGTGCACATGGACAAGACCTAGGTACTCTGGGCAGCTGCCTGC
AG
CGATTCACCACAATGCCGTTCTTATTCTGTAACATCAATAATGTATGTAACTTTGCATCACGAAATGA
T
TATTCATACTGGCTGTCAACACCAGCTCTGATGCCAATGGACATGGCTCCAATTAGTGGCAGAGCTCTC
GAA
CCCTATATTAGCAGATGCACCGTCTGTGAAGGTCCAGCAATGGCCATAGCTGTTCACAGTCAAACTA
CT
GCTATCCCTCCGTGTCCCCAGGACTGGGTTTCTCTCTGGAAAGGTTTTTCTTTCATTATGTTCACAAG
T
GCAGGCTCTGAGGGTGCTGGACAAGCACTTGCCTCGCCTGGCTCCTGCCTGGAAGAATTCCGAGCCAGT
CCA
TTTATAGAATGCCATGGACGAGGGACATGTAACTACTACTCAAACTCCTACAGTTTCTGGCTGGCTT
CG
CTGAACCCAGAAAGAATGTTCAGAAAACCTATTCCATCAACTGTGAAAGCTGGAGACTTAGAGAAAAT
C
ATAAGCCGCTGTCAGGTGTGCATGAAGAAAAGACATTGA


Translation (1669 aa):
MHSKTAPRFLVFLLLTLLLLLAASPVASKGCVCKGKGQCLCAGTKGEKGEKGVPGSPGFPGQKGFPGPEG
L
PGPQGPK
GSPGLPGLTGPKGIRGITGLPGFAGPPGLPGLPGHPGPRGLAGLPGCNGSKGEQGFPGFPGT
P
GYAGLP
GPDGLKGQKGEPAQGEDRGFNGKGDPGPPGVPGFQGFPGLPGFPGPAGPPGPPGFFGLPGAMG
P
RGPK
GHMGDSVIGQKGERGMKGLTGPPGPPGTVIFTLTQPYNKSDFKGEKGDEGERGEPGPPGPSGPPG
D
SYGSEKGAPGEPGPR
GKPGKDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAY
L
EKGERGMPGLPGPKGARGPQ
GPSGPPGVPGSPGLSRPGLRGPIGWPGLKGSKGERGPPGKDTVGPPGPL
G
CPGSPGPPGPPGPPGCP
GDIVFKCSPGEHGMPGDTGPPGVPGLDGPKGEPGSPCTECHCFPGPPGVPGF
P
GLDGIKGIP
GGRGVPGLKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDKGDTPLPWGQVGNPGDPGLRGL
P
GRKGFDGTPGGPGAKGPPGPQGEP
ALSGRKGDQGPPGPPGFPGPPGPAGPAGPPGYGPQGEPGPKGAQG
V
PGVLGPPGEA
GLKGEPSTSTPDLGPPGPPGPPGQAGPRGLPGLPGPVGKCDPGLPGPDGEPGIPEAGCP
G
PPGPK
GNQGFPGTKGSPGCPGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGDIGL
P
GLPGLPGTPGRGGLDGPP
GDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPG
I
PGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPP
GEKGEVGMMGYPGTTGPPGLPGKPGSQ
G
QR
GSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKG
L
EGLPGLPGPP
GPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGD
K
GEPGYSEGARPGPPGPK
GDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLG
L
KGQKGFPGPPGSTGPP
GPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKG
D
RGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNP
GEPGPPGPPGPI
G
KGIKGDKGFMGPPGPKGLPGTVGDMGPPGFP
GAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGPIGH
P
GPVGPKGPP
GPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPGIPGPCGPRGKPGKDGKPGTP
G
PAGTKGNKGLKGQQ
GPPGLDGLPGLKGNPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPEGTQPLYSGF
S
LLFVQGNKRAHGQDL
GTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRAL
E
PYIS
RCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRAS
P
FIECHGRGTCNYYSNSYSFWLASLNPERMF
RKPIPSTVKAGDLEKIISRCQVCMKKRH



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser