NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS41019.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41019.1 Public Mus musculus X Rpl10 16 104 75 CCDS HistoryNCBI Gene:110954Re-query CCDS DB by CCDS ID:41019.1

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 41019.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000008826 ENSMUSP00000008826 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000008826Link to Ensembl Protein Viewer:ENSMUSP00000008826Re-query CCDS DB by Nucleotide ID:ENSMUST00000008826Re-query CCDS DB by Protein ID:ENSMUSP00000008826
Original member Current member EBI,WTSI ENSMUST00000074085 ENSMUSP00000082055 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000074085Link to Ensembl Protein Viewer:ENSMUSP00000082055Re-query CCDS DB by Nucleotide ID:ENSMUST00000074085Re-query CCDS DB by Protein ID:ENSMUSP00000082055
Original member Current member EBI,WTSI OTTMUST00000042845 OTTMUSP00000019234 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042845Link to Vega Protein Viewer:OTTMUSP00000019234Re-query CCDS DB by Nucleotide ID:OTTMUST00000042845Re-query CCDS DB by Protein ID:OTTMUSP00000019234
Original member Current member EBI,WTSI OTTMUST00000043843 OTTMUSP00000019685 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043843Link to Vega Protein Viewer:OTTMUSP00000019685Re-query CCDS DB by Nucleotide ID:OTTMUST00000043843Re-query CCDS DB by Protein ID:OTTMUSP00000019685
Original member Current member NCBI NM_052835.3 NP_443067.1 Accepted alive Link to Nucleotide Sequence:NM_052835.3Link to Protein Sequence:NP_443067.1Re-query CCDS DB by Nucleotide ID:NM_052835Re-query CCDS DB by Protein ID:NP_443067Link to BLink:NP_443067.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_443067.1 214 Q6ZWV3 214 100% 0 0

Chromosomal Locations for CCDS 41019.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 74271002 74271024 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74271660 74271718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74271800 74271907 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74272179 74272317 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74272672 74272834 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74272915 74273067 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (645 nt):
ATGGGCCGCCGCCCCGCCCGGTGTTACCGGTATTGTAAGAACAAGCCATACCCAAAGTCTCGTTTCTGCC
GT
GGTGTCCCTGATGCTAAGATCCGAATCTTTGATTTGGGACGGAAGAAAGCAAAAGTTGATGAATTCCC
A
CTTTGTGGCCATATGGTGTCAGATGAATATGAGCAACTCTCTTCTGAAGCACTGGAGGCTGCCCGTATT
TGT
GCCAACAAATACATGGTAAAGAGTTGTGGCAAGGATGGCTTTCATATCCGAGTGAGGCTCCACCCTT
TC
CATGTCATCCGTATCAACAAGATGTTGTCCTGTGCTGGGGCTGACAGGCTCCAGACAGGGATGCGTGG
T
GCCTTTGGGAAGCCCCAGGGCACAGTGGCCAGGGTTCACATTGGCCAGGTCATCATGTCCATCCGAACC
AAG
TTGCAGAACAAGGAACATGTGATTGAGGCTCTGCGAAGAGCCAAGTTCAAGTTCCCTGGCCGCCAGA
AG
ATCCACATCTCAAAGAAGTGGGGCTTCACCAAGTTTAATGCAGATGAATTTGAAGACATGGTTGCTGA
G
AAGCGGCTCATTCCTGATGGCTGTGGTGTCAAATATATCCCCAATCGTGGTCCTCTGGACAAGTGGAGA
GCC
CTGCATTCCTGA


Translation (214 aa):
MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARI
C
ANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGAD
RLQTGMRGAFGKPQGTVARVHIGQVIMSIRT
K
LQNKEHVIEALRRAKFKFPGRQK
IHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKWR
A
LHS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser