NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS45896.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45896.1 Public Homo sapiens 19 STK11 17 106 76 CCDS HistoryNCBI Gene:6794Re-query CCDS DB by CCDS ID:45896.1Re-query CCDS DB by GeneID:6794See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Sequence IDs included in CCDS 45896.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000326873 ENSP00000324856 Accepted alive Link to Ensembl Transcript Viewer:ENST00000326873Link to Ensembl Protein Viewer:ENSP00000324856Re-query CCDS DB by Nucleotide ID:ENST00000326873Re-query CCDS DB by Protein ID:ENSP00000324856
Original member Current member EBI,WTSI OTTHUMT00000449839 OTTHUMP00000263382 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000449839Link to Vega Protein Viewer:OTTHUMP00000263382Re-query CCDS DB by Nucleotide ID:OTTHUMT00000449839Re-query CCDS DB by Protein ID:OTTHUMP00000263382
Original member Current member NCBI NM_000455.4 NP_000446.1 Accepted alive Link to Nucleotide Sequence:NM_000455.4Link to Protein Sequence:NP_000446.1Re-query CCDS DB by Nucleotide ID:NM_000455Re-query CCDS DB by Protein ID:NP_000446Link to BLink:NP_000446.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000446.1 433 Q15831-1 433 100% 0 0

Chromosomal Locations for CCDS 45896.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 1206914 1207203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1218417 1218500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1219324 1219413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1220373 1220505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1220581 1220717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1221213 1221340 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1221949 1222006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1222985 1223172 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1226454 1226647 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1302 nt):
ATGGAGGTGGTGGACCCGCAGCAGCTGGGCATGTTCACGGAGGGCGAGCTGATGTCGGTGGGTATGGACA
CG
TTCATCCACCGCATCGACTCCACCGAGGTCATCTACCAGCCGCGCCGCAAGCGGGCCAAGCTCATCGG
C
AAGTACCTGATGGGGGACCTGCTGGGGGAAGGCTCTTACGGCAAGGTGAAGGAGGTGCTGGACTCGGAG
ACG
CTGTGCAGGAGGGCCGTCAAGATCCTCAAGAAGAAGAAGTTGCGAAGGATCCCCAACGGGGAGGCCA
AC
GTGAAGAAGGAAATTCAACTACTGAGGAGGTTACGGCACAAAAATGTCATCCAGCTGGTGGATGTGTT
A
TACAACGAAGAGAAGCAGAAAATGTATATGGTGATGGAGTACTGCGTGTGTGGCATGCAGGAAATGCTG
GAC
AGCGTGCCGGAGAAGCGTTTCCCAGTGTGCCAGGCCCACGGGTACTTCTGTCAGCTGATTGACGGCC
TG
GAGTACCTGCATAGCCAGGGCATTGTGCACAAGGACATCAAGCCGGGGAACCTGCTGCTCACCACCGG
T
GGCACCCTCAAAATCTCCGACCTGGGCGTGGCCGAGGCACTGCACCCGTTCGCGGCGGACGACACCTGC
CGG
ACCAGCCAGGGCTCCCCGGCTTTCCAGCCGCCCGAGATTGCCAACGGCCTGGACACCTTCTCCGGCT
TC
AAGGTGGACATCTGGTCGGCTGGGGTCACCCTCTACAACATCACCACGGGTCTGTACCCCTTCGAAGG
G
GACAACATCTACAAGTTGTTTGAGAACATCGGGAAGGGGAGCTACGCCATCCCGGGCGACTGTGGCCCC
CCG
CTCTCTGACCTGCTGAAAGGGATGCTTGAGTACGAACCGGCCAAGAGGTTCTCCATCCGGCAGATCC
GG
CAGCACAGCTGGTTCCGGAAGAAACATCCTCCGGCTGAAGCACCAGTGCCCATCCCACCGAGCCCAGA
C
ACCAAGGACCGGTGGCGCAGCATGACTGTGGTGCCGTACTTGGAGGACCTGCACGGCGCGGACGAGGAC
GAG
GACCTCTTCGACATCGAGGATGACATCATCTACACTCAGGACTTCACGGTGCCCGGACAGGTCCCAG
AA
GAGGAGGCCAGTCACAATGGACAGCGCCGGGGCCTCCCCAAGGCCGTGTGTATGAACGGCACAGAGGC
G
GCGCAGCTGAGCACCAAATCCAGGGCGGAGGGCCGGGCCCCCAACCCTGCCCGCAAGGCCTGCTCCGCC
AGC
AGCAAGATCCGCCGGCTGTCGGCCTGCAAGCAGCAGTGA


Translation (433 aa):
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE
T
LCRRAVKILKKKKLRRIPNGEANVK
KEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEML
D
SVPEKRFPVCQAH
GYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTC
R
TSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVT
LYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGP
P
LSDLLK
GMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADED
E
DLFDIEDDIIYTQDFTVP
GQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
S
SKIRRLSACKQQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser