NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1821.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1821.1 Public Homo sapiens 2 SIX3 17 106 76 CCDS HistoryNCBI Gene:6496Re-query CCDS DB by CCDS ID:1821.1Re-query CCDS DB by GeneID:6496See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 1821.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000260653 ENSP00000260653 Accepted alive Link to Ensembl Transcript Viewer:ENST00000260653Link to Ensembl Protein Viewer:ENSP00000260653Re-query CCDS DB by Nucleotide ID:ENST00000260653Re-query CCDS DB by Protein ID:ENSP00000260653
Original member Current member EBI,WTSI OTTHUMT00000326192 OTTHUMP00000201650 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000326192Link to Vega Protein Viewer:OTTHUMP00000201650Re-query CCDS DB by Nucleotide ID:OTTHUMT00000326192Re-query CCDS DB by Protein ID:OTTHUMP00000201650
Original member Current member NCBI NM_005413.3 NP_005404.1 Accepted alive Link to Nucleotide Sequence:NM_005413.3Link to Protein Sequence:NP_005404.1Re-query CCDS DB by Nucleotide ID:NM_005413Re-query CCDS DB by Protein ID:NP_005404Link to BLink:NP_005404.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005404.1 332 O95343 332 100% 0 0

Chromosomal Locations for CCDS 1821.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 44942105 44942910 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 44944568 44944760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (999 nt):
ATGGTATTCCGCTCCCCCCTAGACCTCTATTCCTCCCACTTCTTGTTGCCAAACTTCGCCGATTCTCACC
AC
CGCTCCATACTTCTGGCGAGTAGCGGCGGCGGGAACGGTGCGGGAGGCGGCGGCGGCGCGGGAGGCGG
C
AGCGGCGGCGGGAACGGTGCGGGAGGCGGCGGTGCTGGCGGAGCAGGCGGCGGCGGCGGCGGCGGCTCC
AGG
GCCCCCCCGGAAGAGTTGTCCATGTTCCAGCTGCCCACCCTCAACTTCTCGCCGGAGCAGGTGGCCA
GC
GTCTGTGAGACGCTGGAGGAGACGGGCGACATCGAGCGGCTGGGCCGCTTCCTCTGGTCGCTGCCCGT
G
GCCCCCGGGGCGTGCGAGGCCATCAACAAACACGAGTCGATCCTGCGCGCGCGCGCCGTGGTCGCCTTC
CAC
ACGGGCAACTTCCGCGACCTCTACCACATCCTTGAGAACCACAAGTTCACCAAGGAGTCTCACGGCA
AG
CTGCAGGCCATGTGGCTCGAGGCGCACTACCAGGAGGCCGAGAAGCTGCGCGGCCGCCCACTCGGCCC
G
GTGGACAAGTACCGCGTGCGCAAGAAGTTCCCGCTGCCACGCACCATCTGGGACGGCGAGCAGAAGACG
CAT
TGCTTCAAGGAGCGGACTCGGAGCCTGTTGCGGGAGTGGTACCTACAGGACCCCTACCCCAACCCCA
GC
AAGAAACGCGAACTGGCGCAGGCCACCGGCCTCACTCCCACACAAGTAGGCAACTGGTTTAAGAACCG
G
CGGCAGCGCGACCGCGCCGCGGCGGCCAAGAACAGGCTCCAGCACCAGGCCATTGGACCGAGCGGCATG
CGC
TCGCTGGCCGAGCCCGGCTGCCCCACGCACGGCTCGGCAGAGTCGCCGTCCACGGCGGCCAGCCCGA
CC
ACCAGCGTGTCCAGCCTGACGGAGCGCGCAGACACCGGCACCTCCATCCTCTCGGTAACCTCCAGCGA
C
TCGGAATGTGATGTATGA


Translation (332 aa):
MVFRSPLDLYSSHFLLPNFADSHHRSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGS
R
APPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAF
H
TGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKT
H
CFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN
RLQHQAIGPSGM
R
SLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser