NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10065.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10065.1 Public Homo sapiens 15 DNAJC17 17 106 76 CCDS HistoryNCBI Gene:55192Re-query CCDS DB by CCDS ID:10065.1Re-query CCDS DB by GeneID:55192

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 10065.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000220496 ENSP00000220496 Accepted alive Link to Ensembl Transcript Viewer:ENST00000220496Link to Ensembl Protein Viewer:ENSP00000220496Re-query CCDS DB by Nucleotide ID:ENST00000220496Re-query CCDS DB by Protein ID:ENSP00000220496
Original member Current member EBI,WTSI OTTHUMT00000252356 OTTHUMP00000160542 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000252356Link to Vega Protein Viewer:OTTHUMP00000160542Re-query CCDS DB by Nucleotide ID:OTTHUMT00000252356Re-query CCDS DB by Protein ID:OTTHUMP00000160542
Original member Current member NCBI NM_018163.2 NP_060633.1 Accepted alive Link to Nucleotide Sequence:NM_018163.2Link to Protein Sequence:NP_060633.1Re-query CCDS DB by Nucleotide ID:NM_018163Re-query CCDS DB by Protein ID:NP_060633Link to BLink:NP_060633.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060633.1 304 Q9NVM6 304 100% 0 0

Chromosomal Locations for CCDS 10065.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

Chromosome Start Stop Links
15 40767940 40768062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40773727 40773837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40774356 40774436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40775031 40775108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40775553 40775596 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40776196 40776292 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40776542 40776627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40779223 40779310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40779545 40779603 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40779928 40779997 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 40807369 40807446 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (915 nt):
ATGGCAGTGACCAAGGAGCTCTTACAGATGGACCTGTACGCGCTGCTAGGCATTGAGGAGAAGGCAGCGG
AC
AAAGAGGTAAAGAAGGCGTATAGGCAGAAGGCCCTCTCCTGCCACCCAGACAAAAATCCAGATAATCC
C
AGAGCAGCTGAACTCTTCCACCAGCTTTCTCAGGCCTTGGAGGTGCTGACCGATGCTGCAGCCAGGGCT
GCA
TATGACAAGGTCAGGAAAGCCAAGAAGCAAGCAGCAGAGAGGACCCAGAAACTTGATGAGAAAAGGA
AG
AAAGTGAAGCTTGACCTGGAGGCCCGGGAGCGGCAGGCCCAGGCCCAGGAGAGTGAGGAGGAAGAGGA
G
AGCCGGAGCACCAGGACACTAGAGCAAGAGATCGAACGCCTGAGAGAAGAGGGTTCCCGGCAGCTGGAG
GAA
CAGCAGAGGCTCATCCGGGAGCAGATACGCCAGGAGCGTGACCAGAGGTTGAGAGGAAAGGCAGAAA
AT
ACTGAAGGCCAAGGAACCCCCAAACTAAAGCTAAAATGGAAGTGCAAGAAGGAGGATGAGTCAAAAGG
T
GGCTACTCCAAAGACGTCCTCCTACGGCTTTTGCAGAAGTATGGTGAGGTTCTCAACCTGGTGCTTTCC
AGT
AAGAAGCCAGGCACTGCTGTGGTGGAGTTTGCAACCGTCAAGGCAGCGGAGCTGGCTGTCCAGAATG
AA
GTTGGCCTGGTGGATAACCCTCTGAAGATTTCCTGGTTGGAGGGACAGCCCCAGGATGCCGTGGGCCG
C
AGCCACTCAGGACTGTCAAAGGGCTCAGTGCTGTCAGAGAGGGACTACGAGAGCCTCGTCATGATGCGC
ATG
CGCCAGGCGGCCGAGCGGCAACAGCTGATCGCACGGATGCAGCAGGAAGACCAGGAGGGGCCGCCTA
CG
TAG


Translation (304 aa):
MAVTKELLQMDLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARA
A
YDKVRKAKKQAAERTQKLDEKRKKVKL
DLEARERQAQAQESEEEEESRSTRTLEQEIERLREEGSRQLE
E
QQRLIREQIRQERDQRLR
GKAENTEGQGTPKLKLKWKCKKEDESKGGYSKDVLLRLLQKYGEVLNLVLS
S
KKPGTAVVEFATVKAA
ELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMR
M
RQAAERQQLIARMQQEDQEGPPT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser