NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10148.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10148.1 Public Homo sapiens 15 BCL2L10 15 105 74 CCDS HistoryNCBI Gene:10017Re-query CCDS DB by CCDS ID:10148.1Re-query CCDS DB by GeneID:10017

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 10148.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000260442 ENSP00000260442 Accepted alive Link to Ensembl Transcript Viewer:ENST00000260442Link to Ensembl Protein Viewer:ENSP00000260442Re-query CCDS DB by Nucleotide ID:ENST00000260442Re-query CCDS DB by Protein ID:ENSP00000260442
Original member Current member EBI,WTSI OTTHUMT00000254843 OTTHUMP00000162719 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000254843Link to Vega Protein Viewer:OTTHUMP00000162719Re-query CCDS DB by Nucleotide ID:OTTHUMT00000254843Re-query CCDS DB by Protein ID:OTTHUMP00000162719
Original member Current member NCBI NM_020396.2 NP_065129.1 Accepted alive Link to Nucleotide Sequence:NM_020396.2Link to Protein Sequence:NP_065129.1Re-query CCDS DB by Nucleotide ID:NM_020396Re-query CCDS DB by Protein ID:NP_065129Link to BLink:NP_065129.1

Chromosomal Locations for CCDS 10148.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 15 (NC_000015.9)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

Chromosome Start Stop Links
15 52402045 52402170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 52404435 52404923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (615 nt):
ATGGTTGACCAGTTGCGGGAGCGCACCACCATGGCCGACCCGCTGCGGGAGCGCACCGAGCTGTTGCTGG
CC
GACTACCTGGGGTACTGCGCCCGGGAACCCGGCACCCCCGAGCCGGCGCCATCCACGCCCGAGGCCGC
C
GTGCTGCGCTCCGCGGCCGCCAGGTTACGGCAGATTCACCGGTCCTTTTTCTCCGCCTACCTCGGCTAC
CCC
GGGAACCGCTTCGAGCTGGTGGCGCTGATGGCGGATTCCGTGCTCTCCGACAGCCCCGGCCCCACCT
GG
GGCAGAGTGGTGACGCTCGTGACCTTCGCAGGGACGCTGCTGGAGAGAGGGCCGCTGGTGACCGCCCG
G
TGGAAGAAGTGGGGCTTCCAGCCGCGGCTAAAGGAGCAGGAGGGCGACGTCGCCCGGGACTGCCAGCGC
CTG
GTGGCCTTGCTGAGCTCGCGGCTCATGGGGCAGCACCGCGCCTGGCTGCAGGCTCAGGGCGGCTGGG
AT
GGCTTTTGTCACTTCTTCAGGACCCCCTTTCCACTGGCTTTTTGGAGAAAACAGCTGGTCCAGGCTTT
T
CTGTCATGCTTGTTAACAACAGCCTTCATTTATCTCTGGACACGATTATTATGA


Translation (204 aa):
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY
P
GNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQR
L
VALLSSRLMGQHRAWLQAQGGW
DGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser