NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS44980.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44980.1 Public Homo sapiens 12 OAS1 17 106 76 CCDS HistoryNCBI Gene:4938Re-query CCDS DB by CCDS ID:44980.1Re-query CCDS DB by GeneID:4938

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Sequence IDs included in CCDS 44980.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000452357 ENSP00000415721 Accepted alive Link to Ensembl Transcript Viewer:ENST00000452357Link to Ensembl Protein Viewer:ENSP00000415721Re-query CCDS DB by Nucleotide ID:ENST00000452357Re-query CCDS DB by Protein ID:ENSP00000415721
Original member Current member EBI,WTSI OTTHUMT00000405906 OTTHUMP00000242104 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000405906Link to Vega Protein Viewer:OTTHUMP00000242104Re-query CCDS DB by Nucleotide ID:OTTHUMT00000405906Re-query CCDS DB by Protein ID:OTTHUMP00000242104
Original member Current member NCBI NM_002534.2 NP_002525.2 Accepted alive Link to Nucleotide Sequence:NM_002534.2Link to Protein Sequence:NP_002525.2Re-query CCDS DB by Nucleotide ID:NM_002534Re-query CCDS DB by Protein ID:NP_002525Link to BLink:NP_002525.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002525.2 364 P00973-2 364 100% 0 0

Chromosomal Locations for CCDS 44980.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

Chromosome Start Stop Links
12 112907040 112907219 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 112908536 112908824 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 112911051 112911235 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 112916509 112916738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 112917547 112917757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1095 nt):
ATGATGGATCTCAGAAATACCCCAGCCAAATCTCTGGACAAGTTCATTGAAGACTATCTCTTGCCAGACA
CG
TGTTTCCGCATGCAAATCAACCATGCCATTGACATCATCTGTGGGTTCCTGAAGGAAAGGTGCTTCCG
A
GGTAGCTCCTACCCTGTGTGTGTGTCCAAGGTGGTAAAGGGTGGCTCCTCAGGCAAGGGCACCACCCTC
AGA
GGCCGATCTGACGCTGACCTGGTTGTCTTCCTCAGTCCTCTCACCACTTTTCAGGATCAGTTAAATC
GC
CGGGGAGAGTTCATCCAGGAAATTAGGAGACAGCTGGAAGCCTGTCAAAGAGAGAGAGCATTTTCCGT
G
AAGTTTGAGGTCCAGGCTCCACGCTGGGGCAACCCCCGTGCGCTCAGCTTCGTACTGAGTTCGCTCCAG
CTC
GGGGAGGGGGTGGAGTTCGATGTGCTGCCTGCCTTTGATGCCCTGGGTCAGTTGACTGGCGGCTATA
AA
CCTAACCCCCAAATCTATGTCAAGCTCATCGAGGAGTGCACCGACCTGCAGAAAGAGGGCGAGTTCTC
C
ACCTGCTTCACAGAACTACAGAGAGACTTCCTGAAGCAGCGCCCCACCAAGCTCAAGAGCCTCATCCGC
CTA
GTCAAGCACTGGTACCAAAATTGTAAGAAGAAGCTTGGGAAGCTGCCACCTCAGTATGCCCTGGAGC
TC
CTGACGGTCTATGCTTGGGAGCGAGGGAGCATGAAAACACATTTCAACACAGCCCAGGGATTTCGGAC
G
GTCTTGGAATTAGTCATAAACTACCAGCAACTCTGCATCTACTGGACAAAGTATTATGACTTTAAAAAC
CCC
ATTATTGAAAAGTACCTGAGAAGGCAGCTCACGAAACCCAGGCCTGTGATCCTGGACCCGGCGGACC
CT
ACAGGAAACTTGGGTGGTGGAGACCCAAAGGGTTGGAGGCAGCTGGCACAAGAGGCTGAGGCCTGGCT
G
AATTACCCATGCTTTAAGAATTGGGATGGGTCCCCAGTGAGCTCCTGGATTCTGCTGGTGAGACCTCCT
GCT
TCCTCCCTGCCATTCATCCCTGCCCCTCTCCATGAAGCTTGA


Translation (364 aa):
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTL
R
GRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ
L
GEGVEFDVLPAFDAL
GQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIR
L
VKHWYQN
CKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKN
P
IIEKYLRRQLTKP
RPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPP
A
SSLPFIPAPLHEA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser