NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS43182.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43182.1 Public Homo sapiens 3 DGKG 17 106 76 CCDS HistoryNCBI Gene:1608Re-query CCDS DB by CCDS ID:43182.1Re-query CCDS DB by GeneID:1608

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Sequence IDs included in CCDS 43182.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000344484 ENSP00000339777 Accepted alive Link to Ensembl Transcript Viewer:ENST00000344484Link to Ensembl Protein Viewer:ENSP00000339777Re-query CCDS DB by Nucleotide ID:ENST00000344484Re-query CCDS DB by Protein ID:ENSP00000339777
Original member Current member EBI,WTSI OTTHUMT00000344844 OTTHUMP00000210200 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000344844Link to Vega Protein Viewer:OTTHUMP00000210200Re-query CCDS DB by Nucleotide ID:OTTHUMT00000344844Re-query CCDS DB by Protein ID:OTTHUMP00000210200
Original member Current member NCBI NM_001080744.1 NP_001074213.1 Accepted alive Link to Nucleotide Sequence:NM_001080744.1Link to Protein Sequence:NP_001074213.1Re-query CCDS DB by Nucleotide ID:NM_001080744Re-query CCDS DB by Protein ID:NP_001074213Link to BLink:NP_001074213.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074213.1 766 P49619-2 766 100% 0 0

Chromosomal Locations for CCDS 43182.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 186150090 186150188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186161603 186161663 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186164898 186165018 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186188202 186188379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186211795 186211885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186242504 186242568 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186251759 186251919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186253093 186253182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186257854 186257939 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186261699 186261778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186265247 186265306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186267685 186267777 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186268801 186268917 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186272255 186272343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186275547 186275664 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186279851 186279973 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186280670 186280744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186284660 186284709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186288710 186288880 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186297421 186297483 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186298064 186298229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186306901 186306977 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186320393 186320459 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2301 nt):
ATGGGTGAAGAACGGTGGGTCTCCCTCACTCCAGAAGAATTTGACCAACTCCAGAAATATTCAGAATATT
CC
TCCAAGAAGATAAAAGATGCCTTGACTGAATTTAATGAGGGTGGGAGCCTCAAACAATATGACCCACA
T
GAGCCGATTAGCTATGATGTCTTCAAGCTGTTCATGAGGGCGTACCTGGAGGTGGACCTTCCCCAGCCA
CTG
AGCACTCACCTCTTCCTGGCCTTCAGCCAGAAGCCCAGACACGAGACCTCTGACCACCCGACGGAGG
GA
GCCAGCAACAGTGAGGCCAACAGCGCAGATACTAATATACAGAATGCAGATAATGCCACCAAAGCAGA
C
GAGGCCTGTGCCCCTGATACTGAATCAAATATGGCTGAGAAGCAAGCACCAGCTGAAGACCAAGTGGCT
GCG
ACCCCCCTGGAACCCCCCGTCCCTCGGTCTTCAAGCTCGGAATCCCCAGTGGTATACCTGAAGGATG
TT
GTGTGCTACCTGTCCCTGCTGGAGACGGGGAGGCCTCAGGATAAGCTGGAGTTCATGTTTCGCCTCTA
T
GATTCAGATGAGAACGGTCTCCTGGACCAAGCGGAGATGGATTGCATTGTCAACCAAATGCTGCATATT
GCC
CAGTACCTGGAGTGGGATCCCACAGAGCTGAGGCCTATATTGAAGGAGATGCTGCAAGGGATGGACT
AC
GACCGGGACGGCTTTGTGTCTCTACAGGAATGGGTCCATGGAGGGATGACCACCATCCCATTGCTGGT
C
CTCCTGGGGATGGATGACTCTGGCTCCAAGGGGGATGGGCGGCACGCCTGGACCATGAAGCACTTCAAG
AAA
CCAACCTACTGCAACTTCTGCCATATCATGCTCATGGGCGTCCGCAAGCAAGGCCTGTGCTGCACTT
AC
TGTAAATACACTGTCCACGAACGCTGTGTGTCCAGAAACATTCCTGGTTGTGTCAAAACGTACTCAAA
A
GCCAAAAGGAGTGGTGAGGTGATGCAGCACGCATGGGTGGAAGGGAACTCCTCCGTCAAGTGTGACCGG
TGC
CACAAAAGTATCAAGTGCTACCAGAGTGTCACCGCGCGGCACTGCGTGTGGTGCCGGATGACGTTTC
AC
CGCAAATGTGAATTATCAACGTTGTGTGACGGTGGGGAACTCAGAGACCACATCTTACTGCCCACCTC
C
ATATGCCCCATCACCCGGGACAGGCCAGGTGAGAAGTCTGATGGCTGCGTGTCCGCCAAGGGCGAACTT
GTC
ATGCAGTATAAGATCATCCCCACCCCGGGTACCCACCCCCTGCTGGTCTTGGTGAACCCCAAGAGTG
GA
GGGAGACAAGGAGAAAGGTTGAACTTTTTCCGTGATACTCCAGACTTCCGTGTTTTGGCCTGTGGTGG
A
GATGGGACAGTTGGCTGGATTTTGGATTGCATTGATAAGGCCAACTTTGCAAAGCATCCACCAGTGGCT
GTC
CTGCCTCTTGGAACAGGAAATGACCTTGCCCGTTGTCTCCGCTGGGGAGGAGGTTATGAAGGGGGCA
GC
TTGACAAAAATCCTGAAAGACATTGAGCAGAGCCCCTTGGTGATGCTGGACCGCTGGCATCTGGAAGT
C
ATCCCCAGAGAGGAAGTGGAAAACGGGGACCAGGTCCCATACAGCATCATGAACAACTATTTCTCCATT
GGT
GTGGACGCTTCCATTGCACACAGATTCCATGTGATGAGAGAGAAACATCCTGAAAAATTCAACAGCA
G
G
ATGAAGAACAAGCTGTGGTACTTTGAATTTGGCACCTCGGAGACTTTTGCAGCGACCTGCAAGAAACT
C
CACGACCACATTGAGTTGGAGTGTGATGGGGTTGGGGTGGACCTGAGCAACATCTTCCTGGAAGGCATT
GCC
ATTCTCAACATTCCCAGCATGTACGGAGGCACCAATCTCTGGGGAGAAAACAAGAAGAACCGGGCTG
TG
ATCCGGGAAAGCAGGAAGGGTGTCACTGACCCCAAAGAACTGAAATTCTGCGTTCAAGACCTCAGTGA
C
CAGCTCCTTGAAGTGGTGGGGCTAGAAGGAGCCATGGAGATGGGGCAGATCTACACCGGCCTGAAGAGT
GCA
GGCAGGAGGCTGGCCCAGTGCGCCTCTGTCACCATCAGGACAAACAAGCTGCTGCCAATGCAAGTGG
AT
GGAGAACCCTGGATGCAGCCATGTTGCACGATTAAAATTACTCACAAGAACCAAGCGCCCATGATGAT
G
GGGCCTCCCCAGAAGAGCAGCTTCTTCTCGTTGAGAAGGAAGAGCCGTTCAAAAGACTAA


Translation (766 aa):
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQP
L
STHLFLAFSQKPRHETSDHPTEGASNSEANSA
DTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVA
A
TPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLE
FMFRLYDSDENGLLDQAEMDCIVNQMLHI
A
QYLEWDPTELRP
ILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFK
K
PTYCNFCHIMLMGVRKQGLCCT
YCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDR
C
HKSIKCYQSVTARHCVWCRMT
FHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL
V
MQ
YKIIPTPGTHPLLVLVNPKSGGRQGERLNFFRDTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVA
V
LPLGTGNDLARCLRWGG
GYEGGSLTKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSI
G
V
DASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGI
A
ILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQ
DLSDQLLEVVGLEGAMEMGQIYTGLKS
A
GRRLAQCASVTI
RTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser