NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS43182.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43182.1 Public Homo sapiens 3 DGKG 15 105 74 CCDS HistoryNCBI Gene:1608Re-query CCDS DB by CCDS ID:43182.1Re-query CCDS DB by GeneID:1608

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Sequence IDs included in CCDS 43182.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000344484 ENSP00000339777 Accepted alive Link to Ensembl Transcript Viewer:ENST00000344484Link to Ensembl Protein Viewer:ENSP00000339777Re-query CCDS DB by Nucleotide ID:ENST00000344484Re-query CCDS DB by Protein ID:ENSP00000339777
Original member Current member EBI,WTSI OTTHUMT00000344844 OTTHUMP00000210200 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000344844Link to Vega Protein Viewer:OTTHUMP00000210200Re-query CCDS DB by Nucleotide ID:OTTHUMT00000344844Re-query CCDS DB by Protein ID:OTTHUMP00000210200
Original member Current member NCBI NM_001080744.1 NP_001074213.1 Accepted alive Link to Nucleotide Sequence:NM_001080744.1Link to Protein Sequence:NP_001074213.1Re-query CCDS DB by Nucleotide ID:NM_001080744Re-query CCDS DB by Protein ID:NP_001074213Link to BLink:NP_001074213.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074213.1 766 P49619-2 766 100% 0 0

Chromosomal Locations for CCDS 43182.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 3 (NC_000003.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 185867879 185867977 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185879392 185879452 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185882687 185882807 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185905991 185906168 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185929584 185929674 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185960293 185960357 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185969548 185969708 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185970882 185970971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185975643 185975728 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185979488 185979567 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185983036 185983095 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185985474 185985566 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185986590 185986706 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185990044 185990132 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185993336 185993453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185997640 185997762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 185998459 185998533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186002449 186002498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186006499 186006669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186015210 186015272 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186015853 186016018 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186024690 186024766 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 186038182 186038248 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2301 nt):
ATGGGTGAAGAACGGTGGGTCTCCCTCACTCCAGAAGAATTTGACCAACTCCAGAAATATTCAGAATATT
CC
TCCAAGAAGATAAAAGATGCCTTGACTGAATTTAATGAGGGTGGGAGCCTCAAACAATATGACCCACA
T
GAGCCGATTAGCTATGATGTCTTCAAGCTGTTCATGAGGGCGTACCTGGAGGTGGACCTTCCCCAGCCA
CTG
AGCACTCACCTCTTCCTGGCCTTCAGCCAGAAGCCCAGACACGAGACCTCTGACCACCCGACGGAGG
GA
GCCAGCAACAGTGAGGCCAACAGCGCAGATACTAATATACAGAATGCAGATAATGCCACCAAAGCAGA
C
GAGGCCTGTGCCCCTGATACTGAATCAAATATGGCTGAGAAGCAAGCACCAGCTGAAGACCAAGTGGCT
GCG
ACCCCCCTGGAACCCCCCGTCCCTCGGTCTTCAAGCTCGGAATCCCCAGTGGTATACCTGAAGGATG
TT
GTGTGCTACCTGTCCCTGCTGGAGACGGGGAGGCCTCAGGATAAGCTGGAGTTCATGTTTCGCCTCTA
T
GATTCAGATGAGAACGGTCTCCTGGACCAAGCGGAGATGGATTGCATTGTCAACCAAATGCTGCATATT
GCC
CAGTACCTGGAGTGGGATCCCACAGAGCTGAGGCCTATATTGAAGGAGATGCTGCAAGGGATGGACT
AC
GACCGGGACGGCTTTGTGTCTCTACAGGAATGGGTCCATGGAGGGATGACCACCATCCCATTGCTGGT
C
CTCCTGGGGATGGATGACTCTGGCTCCAAGGGGGATGGGCGGCACGCCTGGACCATGAAGCACTTCAAG
AAA
CCAACCTACTGCAACTTCTGCCATATCATGCTCATGGGCGTCCGCAAGCAAGGCCTGTGCTGCACTT
AC
TGTAAATACACTGTCCACGAACGCTGTGTGTCCAGAAACATTCCTGGTTGTGTCAAAACGTACTCAAA
A
GCCAAAAGGAGTGGTGAGGTGATGCAGCACGCATGGGTGGAAGGGAACTCCTCCGTCAAGTGTGACCGG
TGC
CACAAAAGTATCAAGTGCTACCAGAGTGTCACCGCGCGGCACTGCGTGTGGTGCCGGATGACGTTTC
AC
CGCAAATGTGAATTATCAACGTTGTGTGACGGTGGGGAACTCAGAGACCACATCTTACTGCCCACCTC
C
ATATGCCCCATCACCCGGGACAGGCCAGGTGAGAAGTCTGATGGCTGCGTGTCCGCCAAGGGCGAACTT
GTC
ATGCAGTATAAGATCATCCCCACCCCGGGTACCCACCCCCTGCTGGTCTTGGTGAACCCCAAGAGTG
GA
GGGAGACAAGGAGAAAGGTTGAACTTTTTCCGTGATACTCCAGACTTCCGTGTTTTGGCCTGTGGTGG
A
GATGGGACAGTTGGCTGGATTTTGGATTGCATTGATAAGGCCAACTTTGCAAAGCATCCACCAGTGGCT
GTC
CTGCCTCTTGGAACAGGAAATGACCTTGCCCGTTGTCTCCGCTGGGGAGGAGGTTATGAAGGGGGCA
GC
TTGACAAAAATCCTGAAAGACATTGAGCAGAGCCCCTTGGTGATGCTGGACCGCTGGCATCTGGAAGT
C
ATCCCCAGAGAGGAAGTGGAAAACGGGGACCAGGTCCCATACAGCATCATGAACAACTATTTCTCCATT
GGT
GTGGACGCTTCCATTGCACACAGATTCCATGTGATGAGAGAGAAACATCCTGAAAAATTCAACAGCA
G
G
ATGAAGAACAAGCTGTGGTACTTTGAATTTGGCACCTCGGAGACTTTTGCAGCGACCTGCAAGAAACT
C
CACGACCACATTGAGTTGGAGTGTGATGGGGTTGGGGTGGACCTGAGCAACATCTTCCTGGAAGGCATT
GCC
ATTCTCAACATTCCCAGCATGTACGGAGGCACCAATCTCTGGGGAGAAAACAAGAAGAACCGGGCTG
TG
ATCCGGGAAAGCAGGAAGGGTGTCACTGACCCCAAAGAACTGAAATTCTGCGTTCAAGACCTCAGTGA
C
CAGCTCCTTGAAGTGGTGGGGCTAGAAGGAGCCATGGAGATGGGGCAGATCTACACCGGCCTGAAGAGT
GCA
GGCAGGAGGCTGGCCCAGTGCGCCTCTGTCACCATCAGGACAAACAAGCTGCTGCCAATGCAAGTGG
AT
GGAGAACCCTGGATGCAGCCATGTTGCACGATTAAAATTACTCACAAGAACCAAGCGCCCATGATGAT
G
GGGCCTCCCCAGAAGAGCAGCTTCTTCTCGTTGAGAAGGAAGAGCCGTTCAAAAGACTAA


Translation (766 aa):
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQP
L
STHLFLAFSQKPRHETSDHPTEGASNSEANSA
DTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVA
A
TPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLE
FMFRLYDSDENGLLDQAEMDCIVNQMLHI
A
QYLEWDPTELRP
ILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFK
K
PTYCNFCHIMLMGVRKQGLCCT
YCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDR
C
HKSIKCYQSVTARHCVWCRMT
FHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL
V
MQ
YKIIPTPGTHPLLVLVNPKSGGRQGERLNFFRDTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVA
V
LPLGTGNDLARCLRWGG
GYEGGSLTKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSI
G
V
DASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGI
A
ILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQ
DLSDQLLEVVGLEGAMEMGQIYTGLKS
A
GRRLAQCASVTI
RTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser