NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS34689.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34689.1 Public Homo sapiens 7 SMURF1 15 105 74 CCDS HistoryNCBI Gene:57154Re-query CCDS DB by CCDS ID:34689.1Re-query CCDS DB by GeneID:57154

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 34689.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000361368 ENSP00000355326 Accepted alive Link to Ensembl Transcript Viewer:ENST00000361368Link to Ensembl Protein Viewer:ENSP00000355326Re-query CCDS DB by Nucleotide ID:ENST00000361368Re-query CCDS DB by Protein ID:ENSP00000355326
Original member Current member EBI,WTSI OTTHUMT00000059366 OTTHUMP00000024663 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000059366Link to Vega Protein Viewer:OTTHUMP00000024663Re-query CCDS DB by Nucleotide ID:OTTHUMT00000059366Re-query CCDS DB by Protein ID:OTTHUMP00000024663
Original member Current member NCBI NM_181349.2 NP_851994.1 Accepted alive Link to Nucleotide Sequence:NM_181349.2Link to Protein Sequence:NP_851994.1Re-query CCDS DB by Nucleotide ID:NM_181349Re-query CCDS DB by Protein ID:NP_851994Link to BLink:NP_851994.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_851994.1 731 Q9HCE7-2 731 100% 0 0

Chromosomal Locations for CCDS 34689.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 7 (NC_000007.13)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 98628207 98628306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98630660 98630744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98633138 98633339 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98634690 98634810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98636011 98636148 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98638001 98638179 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98639741 98639855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98643321 98643424 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98645307 98645505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98647186 98647332 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98648980 98649064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98649828 98650069 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98652413 98652488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98654828 98654893 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98655041 98655174 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98658222 98658330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98659422 98659460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 98741349 98741403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2196 nt):
ATGTCGAACCCCGGGACACGCAGGAACGGCTCCAGCATCAAGATCCGTCTGACAGTGTTATGTGCCAAGA
AC
CTTGCAAAGAAAGACTTCTTCAGGCTCCCTGACCCTTTTGCAAAGATTGTCGTGGATGGGTCTGGGCA
G
TGCCACTCAACCGACACTGTGAAAAACACATTGGACCCAAAGTGGAACCAGCACTATGATCTATATGTT
GGG
AAAACGGATTCGATAACCATTAGCGTGTGGAACCATAAGAAAATTCACAAGAAACAGGGAGCTGGCT
TC
CTGGGCTGTGTGCGGCTGCTCTCCAATGCCATCAGCAGATTAAAAGATACCGGATACCAGCGTTTGGA
T
CTATGCAAACTAAACCCCTCAGATACTGATGCAGTTCGTGGCCAGATAGTGGTCAGTTTACAGACACGA
GAC
AGAATAGGAACCGGCGGCTCGGTGGTGGACTGCAGAGGACTGTTAGAAAATGAAGGAACGGTGTATG
AA
GACTCCGGGCCTGGGAGGCCGCTCAGCTGCTTCATGGAGGAACCAGCCCCTTACACAGATAGCACCGG
T
GCTGCTGCTGGAGGAGGGAATTGCAGGTTCGTGGAGTCCCCAAGTCAAGATCAAAGACTTCAGGCACAG
CGG
CTTCGAAACCCTGATGTGCGAGGTTCACTACAGACGCCCCAGAACCGACCACACGGCCACCAGTCCC
CG
GAACTGCCCGAAGGCTACGAACAAAGAACAACAGTCCAGGGCCAAGTTTACTTTTTGCATACACAGAC
T
GGAGTTAGCACGTGGCACGACCCCAGGATACCAAGAGACCTTAACAGTGTGAACTGTGATGAACTTGGA
CCA
CTGCCGCCAGGCTGGGAAGTCAGAAGTACAGTTTCTGGGAGGATATATTTTGTAGATCATAATAACC
GA
ACAACCCAGTTTACAGACCCAAGGTTACACCACATCATGAATCACCAGTGCCAACTCAAGGAGCCCAG
C
CAGCCGCTGCCACTGCCCAGTGAGGGCTCTCTGGAGGACGAGGAGCTTCCTGCCCAGAGATACGAAAGA
GAT
CTAGTCCAGAAGCTGAAAGTCCTCAGACACGAACTGTCGCTTCAGCAGCCCCAAGCTGGTCATTGCC
GC
ATCGAAGTGTCCAGAGAAGAAATCTTTGAGGAGTCTTACCGCCAGATAATGAAGATGCGACCGAAAGA
C
TTGAAAAAACGGCTGATGGTGAAATTCCGTGGGGAAGAAGGTTTGGATTACGGTGGTGTGGCCAGGGAG
TGG
CTTTACTTGCTGTGCCATGAAATGCTGAATCCTTATTACGGGCTCTTCCAGTATTCTACGGACAATA
TT
TACATGTTGCAAATAAATCCGGATTCTTCAATCAACCCCGACCACTTGTCTTATTTCCACTTTGTGGG
G
CGGATCATGGGGCTGGCTGTGTTCCATGGACACTACATCAACGGGGGCTTCACAGTGCCCTTCTACAAG
CAG
CTGCTGGGGAAGCCCATCCAGCTCTCAGATCTGGAATCTGTGGACCCAGAGCTGCATAAGAGCTTGG
TG
TGGATCCTAGAGAACGACATCACGCCTGTACTGGACCACACCTTCTGCGTGGAACACAACGCCTTCGG
G
CGGATCCTGCAGCATGAACTGAAACCCAATGGCAGAAATGTGCCAGTCACAGAGGAGAATAAGAAAGAA
TAC
GTCCGGTTGTATGTAAACTGGAGGTTTATGAGAGGAATCGAAGCCCAGTTCTTAGCTCTGCAGAAGG
GG
TTCAATGAGCTCATCCCTCAACATCTGCTGAAGCCTTTTGACCAGAAGGAACTGGAGCTGATCATAGG
C
GGCCTGGATAAAATAGACTTGAACGACTGGAAGTCGAACACGCGGCTGAAGCACTGTGTGGCCGACAGC
AAC
ATCGTGCGGTGGTTCTGGCAAGCGGTGGAGACGTTCGATGAAGAAAGGAGGGCCAGGCTCCTGCAGT
TT
GTGACTGGGTCCACGCGAGTCCCGCTCCAAGGCTTCAAGGCTTTGCAAGGTTCTACAGGCGCGGCAGG
G
CCCCGGCTGTTCACCATCCACCTGATAGACGCGAACACAGACAACCTTCCGAAGGCCCATACCTGCTTT
AAC
CGGATCGACATTCCACCATATGAGTCCTATGAGAAGCTCTACGAGAAGCTGCTGACAGCCGTGGAGG
AG
ACCTGCGGGTTTGCTGTGGAGTGA


Translation (731 aa):
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYV
G
KTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTG
YQRLDLCKLNPSDTDAVRGQIVVSLQTR
D
RIGTGGSVVDCRGLLENE
GTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQ
R
LRNPDVRGSLQTPQNRPHGHQSPELPEGY
EQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELG
P
LPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIM
NHQCQLKEPSQPLPLPSEGSLEDEELPAQRYER
D
LVQKLKVLRHELSLQQPQAGHCRIEVSREEIFE
ESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVARE
W
LYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINP
DHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYK
Q
LLGKPIQLSDLESVDPELHKSLVWI
LENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKE
Y
V
RLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADS
N
IVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQ
GSTGAAGPRLFTIHLIDANTDNLPKAHTCF
N
RIDIPPYESYEKLYEKLLTAVEETCGFAVE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser