NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS30735.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30735.1 Public Homo sapiens 1 ALG6 17 106 76 CCDS HistoryNCBI Gene:29929Re-query CCDS DB by CCDS ID:30735.1Re-query CCDS DB by GeneID:29929

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 30735.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000371108 ENSP00000360149 Accepted alive Link to Ensembl Transcript Viewer:ENST00000371108Link to Ensembl Protein Viewer:ENSP00000360149Re-query CCDS DB by Nucleotide ID:ENST00000371108Re-query CCDS DB by Protein ID:ENSP00000360149
Original member Current member EBI,WTSI OTTHUMT00000025330 OTTHUMP00000010712 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000025330Link to Vega Protein Viewer:OTTHUMP00000010712Re-query CCDS DB by Nucleotide ID:OTTHUMT00000025330Re-query CCDS DB by Protein ID:OTTHUMP00000010712
Original member Current member NCBI NM_013339.3 NP_037471.2 Accepted alive Link to Nucleotide Sequence:NM_013339.3Link to Protein Sequence:NP_037471.2Re-query CCDS DB by Nucleotide ID:NM_013339Re-query CCDS DB by Protein ID:NP_037471Link to BLink:NP_037471.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_037471.2 507 Q9Y672 507 99.8028% 0 1

Chromosomal Locations for CCDS 30735.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 63370978 63371059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63396513 63396597 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63402254 63402343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63404453 63404541 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63406317 63406399 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63407062 63407126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63411146 63411331 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63411926 63412061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63414061 63414146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63415873 63415957 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63419370 63419440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63428733 63428801 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63428928 63429126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 63436823 63437020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1524 nt):
ATGGAGAAATGGTACTTGATGACAGTAGTGGTTTTAATAGGACTAACAGTACGATGGACAGTGTCTCTTA
AT
TCTTATTCAGGTGCTGGTAAACCGCCTATGTTTGGTGATTATGAAGCTCAGAGACACTGGCAAGAAAT
A
ACTTTTAATTTACCGGTCAAACAATGGTATTTTAACAGCAGTGATAACAATTTACAGTATTGGGGATTG
GAT
TACCCACCTCTTACAGCTTATCATAGTCTCCTATGTGCATATGTGGCAAAGTTTATAAATCCAGACT
GG
ATTGCTCTCCATACATCACGTGGATATGAGAGTCAGGCACATAAGCTCTTCATGCGTACAACAGTTTT
A
ATTGCTGATCTGCTGATTTACATACCTGCAGTGGTTTTGTACTGTTGTTGCTTAAAAGAAATCTCAACT
AAG
AAAAAGATTGCTAATGCATTATGCATCTTGCTGTATCCAGGCCTTATTCTTATAGACTATGGACATT
TT
CAATATAATTCTGTGAGTCTTGGCTTTGCTTTGTGGGGTGTTCTTGGAATATCTTGTGACTGCGACCT
C
CTAGGGTCACTGGCATTTTGCTTAGCTATAAATTATAAACAGATGGAACTTTACCACGCCTTGCCATTT
TTT
TGCTTTTTACTTGGCAAGTGTTTTAAAAAAGGCCTCAAAGGAAAGGGGTTTGTGTTGCTAGTTAAGC
TA
GCTTGTATTGTTGTGGCTTCCTTCGTTCTCTGCTGGCTGCCATTCTTTACAGAAAGGGAACAAACCCT
G
CAGGTTCTAAGAAGACTCTTCCCGGTTGATCGTGGATTATTTGAGGATAAAGTAGCCAATATTTGGTGC
AGC
TTCAATGTCTTTCTGAAGATTAAGGATATTTTGCCACGTCACATCCAATTAATAATGAGCTTTTGTT
CT
ACGTTTTTGAGCCTGCTTCCTGCATGCATAAAATTAATACTTCAGCCCTCTTCCAAAGGATTCAAATT
T
ACACTGGTTAGCTGTGCGCTATCATTCTTTTTATTTTCTTTCCAAGTACATGAAAAATCCATTCTCTTG
GTG
TCACTACCAGTCTGCTTAGTTTTAAGTGAAATTCCTTTTATGTCTACTTGGTTTTTACTTGTGTCAA
CA
TTTAGTATGCTACCTCTTCTATTGAAGGATGAACTCCTAATGCCCTCTGTTGTGACAACAATGGCATT
T
TTTATAGCTTGTGTAACTTCCTTTTCAATATTTGAAAAGACTTCTGAAGAAGAACTGCAGTTGAAATCC
TTT
TCCATTTCTGTGAGGAAATATCTTCCATGTTTTACATTTCTTTCCAGAATTATACAATATTTGTTTC
TT
ATCTCAGTCATCACTATGGTGCTTCTGACGTTGATGACTGTCACACTGGATCCTCCTCAGAAACTACC
G
GACTTGTTTTCTGTATTGGTGTGTTTTGTATCTTGCTTGAACTTCCTGTTCTTCTTGGTATACTTTAAC
ATT
ATTATTATGTGGGATTCCAAAAGTGGAAGAAATCAGAAGAAAATCAGCTAG


Translation (507 aa):
MEKWYLMTVVVLIGLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGL
D
YPPLTAYHSLLCAY
VAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIYIPAVVLYCCCLKEIST
K
KK
IANALCILLYPGLILIDYGHFQYNSVSLGFALWGVLGISCDCDLLGSLAFCLAINYKQMELYHALPF
F
CFLLGKCFKKGLKGK
GFVLLVKLACIVVASFVLCWLPFFTEREQTLQVLRRLFPVDRGLFEDKVANIWC
S
FNVFLKIKDILPRHIQLIM
SFCSTFLSLLPACIKLILQPSSKGFKFTLVSCALSFFLFSFQVHEKSILL
V
S
LPVCLVLSEIPFMSTWFLLVSTFSMLPLLLKDELLMPSVVTTMAFFIACVTSFSIFEKTSEEELQLKS
F
SISVRKYLPCFTFLSRIIQYL
FLISVITMVLLTLMTVTLDPPQKLPDLFSVLVCFVSCLNFLFFLVYFN
I
IIMWDSKSGRNQKKIS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser