NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57727.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57727.1 Public Mus musculus X Clcn5 16 104 75 CCDS HistoryNCBI Gene:12728Re-query CCDS DB by CCDS ID:57727.1Re-query CCDS DB by GeneID:12728See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 57727.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000115746 ENSMUSP00000111412 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115746Link to Ensembl Protein Viewer:ENSMUSP00000111412Re-query CCDS DB by Nucleotide ID:ENSMUST00000115746Re-query CCDS DB by Protein ID:ENSMUSP00000111412
Original member Current member EBI,WTSI OTTMUST00000039776 OTTMUSP00000017745 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039776Link to Vega Protein Viewer:OTTMUSP00000017745Re-query CCDS DB by Nucleotide ID:OTTMUST00000039776Re-query CCDS DB by Protein ID:OTTMUSP00000017745
Original member Current member NCBI NM_001243762.1 NP_001230691.1 Accepted alive Link to Nucleotide Sequence:NM_001243762.1Link to Protein Sequence:NP_001230691.1Re-query CCDS DB by Nucleotide ID:NM_001243762Re-query CCDS DB by Protein ID:NP_001230691Link to BLink:NP_001230691.1

Chromosomal Locations for CCDS 57727.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 7159729 7159819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7161236 7161452 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7161598 7161996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7163330 7163516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7165580 7166122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7166356 7166436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7170309 7170515 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7171144 7171266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7178301 7178488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7183791 7183890 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7186184 7186335 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7212864 7213010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 7316659 7316674 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2451 nt):
ATGGCCATGTGGCAGGGAGCCATGGATAACAGAGGCTTTCATCAGGGGAGTTTTAGTAGCTTCCAGAGCA
GC
TCTAGTGATGAAGACTTGATGGACATCCCAGGGACTGCTATGGACTTCTCTATGAGAGATGACGTGCC
G
CCTTTAGATCGAGAAATAGAAGGGAACAAGTCATACAATGGTGGTGGAATAGGCTCTTCAAATAGAGTC
ATG
GACTTCTTGGAGGAGCCAATCCCTGGTGTAGGGACCTATGATGATTTCAACACAATTGATTGGGTGA
GA
GAGAAATCTCGAGACCGAGATAGGCACCGAGAGATTACCAATAAAAGCAAAGAGTCAACATGGGCCTT
A
ATTCACAGTGTGAGCGATGCTTTCTCTGGTTGGTTGTTAATGCTCCTTATTGGCCTTTTATCAGGTTCC
TTA
GCTGGCCTGATAGACATCTCTGCTCACTGGATGACAGACTTAAAAGAAGGGATATGTACAGGGGGGT
TC
TGGTTTAACCATGAGCACTGTTGCTGGAATTCTGAGCATGTTACCTTTGAACACAGAGACAAATGTCC
A
GAGTGGAATAGCTGGGCCCAGCTCATCATCAATACAGATCAGGGAGCCTTTGCCTACATAGTCAATTAC
TTC
ATGTACGTCCTCTGGGCTCTTCTGTTTGCTTTCCTTGCTGTATCTCTTGTCAAGGCATTTGCACCTT
AT
GCCTGTGGTTCTGGAATCCCTGAGATCAAAACCATCCTGAGTGGTTTCATTATTAGAGGCTATCTGGG
T
AAGTGGACCCTTGTCATCAAAACTATCACTTTGGTGTTGGCGGTGTCATCTGGCTTGAGCCTGGGCAAG
GAG
GGCCCCCTGGTGCACGTGGCTTGCTGCTGTGGGAACATCTTGTGCCACTGCTTCAACAAATACCGGA
AG
AATGAAGCCAAGCGGAGAGAGGTCTTATCAGCTGCAGCGGCTGCCGGTGTATCTGTAGCCTTTGGGGC
C
CCTATTGGTGGAGTATTATTCAGCCTGGAAGAGGTCAGCTACTACTTTCCCCTCAAAACACTATGGCGT
TCT
TTCTTCGCTGCTCTGGTGGCAGCGTTCACACTCCGCTCCATCAATCCATTCGGAAACAGCCGCTTAG
TT
CTGTTTTATGTGGAGTTCCACACCCCGTGGCATCTCTTTGAGCTCGTGCCATTCATTGTACTAGGCAT
A
TTCGGTGGCCTCTGGGGAGCTCTGTTTATCCGCACAAACATTGCCTGGTGTCGGAAGCGTAAAACCACA
CAG
TTGGGCAAGTATCCTGTCGTCGAGGTACTCATTGTGACGGCCATCACTGCCATCTTGGCTTTCCCCA
AT
GAATATACCCGGATGAGCACAAGTGAGCTCATTTCTGAGCTGTTCAATGACTGCGGCCTCCTGGACTC
C
TCCAAGCTCTGTGATTATGAGAACCACTTCAACACAAGCAAAGGCGGTGAGCTGCCTGACAGACCTGCT
GGC
GTGGGCATCTACAGTGCCATGTGGCAGCTGGCTCTGACACTCATACTGAAAATAGTCATTACTATAT
TC
ACCTTTGGCATGAAGATTCCTTCTGGTCTCTTTATCCCCAGCATGGCTGTCGGTGCTATAGCAGGCCG
T
CTTTTAGGAGTCGGAATGGAGCAACTGGCTTATTACCACCACGACTGGGGCATCTTCAATAGCTGGTGT
AGT
CAGGGAGCTGATTGTATCACCCCTGGCCTTTATGCCATGGTTGGGGCTGCTGCCTGCTTAGGTGGGG
TG
ACTCGGATGACTGTTTCTCTTGTTGTCATAATGTTTGAACTGACTGGTGGCCTGGAATATATTGTGCC
T
CTGATGGCTGCAGCTATGACAAGCAAGTGGGTGGCCGATGCTCTTGGGCGAGAGGGCATTTATGATGCC
CAC
ATCCGTCTCAATGGATACCCCTTTCTTGAAGCCAAAGAAGAATTTGCTCATAAGACTCTGGCAATGG
AT
GTGATGAAGCCCCGGAGAAATGACCCCTTGCTGACTGTCCTTACTCAGGACAGTATGACTGTGGAGGA
T
GTCGAGACCATAATCAGCGAAACCACGTACAGTGGCTTTCCGGTGGTAGTGTCCCGAGAGTCGCAAAGA
CTT
GTAGGCTTTGTTCTTCGAAGAGATCTCATTATTTCAATTGAAAATGCTCGGAAGAAACAGGACGGGG
TT
GTGAGCACTTCCATCATTTATTTCACGGAGCATTCGCCTCCAATGCCTCCATACACCCCACCTACCCT
G
AAGCTTCGGAACATCCTGGACCTCAGCCCCTTCACTGTGACAGACCTTACGCCAATGGAGATCGTGGTG
GAC
ATCTTCCGCAAGCTGGGCCTGCGCCAGTGCCTGGTTACACACAACGGGCGCTTACTTGGAATCATCA
CC
AAAAAGGATGTGTTAAAGCATATAGCACAGATGGCAAACCAAGACCCTGATTCCATTCTCTTCAACTA
G


Translation (816 aa):
MAMWQGAMDNRGFHQGSFSSFQSSSSDEDLMDIPGTAMDFSMRDDVPPLDREIEGNKSYNGGGIGSSNRV
M
DFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHRE
ITNKSKESTWALIHSVSDAFSGWLLMLLIGLLSGS
L
AGLIDISAHWMTDLKEGICTGGFWFNHEHCCWNSEHVTFEHRDKCPEWNSWAQLIINTDQ
GAFAYIVNY
F
MYVLWALLFAFLAVSLVKAFAPYACGSGIPE
IKTILSGFIIRGYLGKWTLVIKTITLVLAVSSGLSLGK
E
GPLVHVACCCGNILCHCFNKYRKNEAKRRE
VLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWR
S
FFAALVAAFTLRSINPFGNSRLVLFYVEFHTPWHLFELVPFIVLGIFGGLWGALFIRTNIAWCRKRKTT
Q
LGKYPVVEVLIVTAITAILAFPNEYTRMSTSELISELFNDCGLLDSSKLCDYENHFNTSKGGELPDRPA
G
VGIYSAMWQLALTLILKIVITIFTFGMK
IPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHDWGIFNSWC
S
QGADCITPGLYAMVGAAACL
GGVTRMTVSLVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDA
H
IRLNGYPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQR
L
VGFVLRRDLIISI
ENARKKQDGVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVV
D
IFRKLGLRQCLVTHN
GRLLGIITKKDVLKHIAQMANQDPDSILFN



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser