NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57381.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57381.1 Public Mus musculus 5 Ncor2 19 105 81 CCDS HistoryNCBI Gene:20602Re-query CCDS DB by CCDS ID:57381.1Re-query CCDS DB by GeneID:20602See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 57381.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111393 ENSMUSP00000107024 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111393Link to Ensembl Protein Viewer:ENSMUSP00000107024Re-query CCDS DB by Nucleotide ID:ENSMUST00000111393Re-query CCDS DB by Protein ID:ENSMUSP00000107024
Original member Current member EBI,WTSI OTTMUST00000041505 OTTMUSP00000018644 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041505Link to Vega Protein Viewer:OTTMUSP00000018644Re-query CCDS DB by Nucleotide ID:OTTMUST00000041505Re-query CCDS DB by Protein ID:OTTMUSP00000018644
Original member Current member NCBI NM_001253904.1 NP_001240833.1 Accepted alive Link to Nucleotide Sequence:NM_001253904.1Link to Protein Sequence:NP_001240833.1Re-query CCDS DB by Nucleotide ID:NM_001253904Re-query CCDS DB by Protein ID:NP_001240833Link to BLink:NP_001240833.1

Chromosomal Locations for CCDS 57381.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 125018167 125018348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125018811 125018990 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125019819 125020046 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125022871 125022924 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125023501 125023646 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125024133 125024282 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125025009 125025202 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125025418 125025563 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125025652 125025804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125026802 125027217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125028612 125028798 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125028882 125029013 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125029120 125029269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125029972 125030226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125030686 125030907 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125032015 125032369 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125033326 125033621 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125033984 125034064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125034356 125034496 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125035976 125036126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125036821 125036918 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125037062 125037166 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125037274 125037379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125037861 125037997 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125038889 125039053 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125041796 125041964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125042745 125042865 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125047940 125048534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125049342 125049395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125050911 125051058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125055733 125055875 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125065840 125065902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125067776 125067948 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125068932 125069077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125079008 125079106 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125081130 125081184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125084881 125085059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125086841 125086934 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125087794 125087966 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125091654 125091720 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125097947 125097999 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125102643 125102699 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125106199 125106312 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 125109893 125109958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6999 nt):
ATGGACCGCGTGGACCGTGAGATCACCATGGTAGAGCAGCAGATCTCCAAGCTGAAGAAGAAGCAGCAAC
AG
TTGGAGGAGGAGGCCGCCAAGCCGCCCGAACCCGAGAAGCCTGTGTCGCCACCACCCATAGAATCAAA
G
CACCGAAGCCTGGTCCAGATCATCTACGATGAGAACCGGAAGAAAGCCGAAGCCGCACACCGGATCCTA
GAA
GGCCTGGGGCCCCAGGTGGAGCTGCCTCTGTACAACCAGCCGTCTGACACACGCCAGTACCATGAAA
AC
ATCAAAATAAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTTAAGCGGAGGAACCACGCGCGCAA
G
CAGTGGGAACAGCGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTAGAGCGC
ATA
GAGAACAATCCGCGAAGGAGGGCCAAGGAGAGCAAGGTGAGGGAGTACTACGAGAAACAGTTCCCGG
AG
ATCCGCAAGCAGCGGGAGCTGCAGGAGCGCATGCAGAGCAGGGTGGGCCAGCGTGGCAGTGGGCTCTC
C
ATGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGTCTGAGCAGGAGAATCTG
GAG
AAGCAGATGCGCCAGCTGGCCGTGATCCCGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGT
TC
ATCAACATGAATGGACTCATGGATGACCCCATGAAGGTCTACAAGGACCGTCAGGTTACCAACATGTG
G
AGCGAGCAGGAGAGGGACACCTTCCGTGAGAAGTTTATGCAGCACCCTAAGAACTTTGGCCTGATTGCC
TCA
TTCCTGGAGAGAAAGACGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATT
AC
AAGAGCTTGGTGAGGCGGAGCTATCGGCGCCGTGGCAAGAGCCAGCAGCAGCAGCAGCAGCAACAACA
G
CAGCAGCAGCAGCAGATGGCACGGAGCAGCCAGGAGGAGAAGGAGGAGAAGGAGAAGGAGAAGGAGGCC
GAC
AAGGAGGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAAGGAGAAGACAGACGACA
CT
TCTGGCGAGGACAACGATGAGAAAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGG
C
CGCCGCAAAGGCCGTATCACGCGCTCCATGGCCAACGAGGCCAACCATGAGGAGACAGCCACCCCACAG
CAA
AGTTCAGAGCTGGCTTCCATGGAGATGAACGAGAGTTCTCGCTGGACTGAGGAAGAGATGGAGACAG
CA
AAGAAAGGCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTATGGTGGGCTCCAAGACCGT
G
TCCCAGTGTAAGAACTTCTACTTCAACTACAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCAC
AAG
CTAAAGATGGAGAAGGAGAGGAACGCTCGGAGGAAGAAGAAGAAGACCCCAGCTGCGGCGAGCGAGG
AG
ACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGAAGCATCAGGCGCAAGTGCCAATGAGGAAGA
G
CTGGCGGAGGAGGCAGAAGCCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGGGGAGTGCAGTGGC
CCA
GCTGCTGTCAACAACAGCTCTGATACTGAGAGTGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACA
CT
GGGCCTAAACCCACTGGCACTGAAGCATTGCCCGCTGCCACCCAGCCACCTGTTCCTCCTCCAGAAGA
A
CCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGTGGCCCACCATCCCCAGAGCCTTCC
CCA
TCACCTGCCGCACCCCCGGCTACTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCC
AG
ACAGAGGATGCCAAGGAGCAGAAGTCTGAGGCCGAGGAGATCGATGTGGGAAAGCCAGAGGAGCCCGA
G
GCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGACCACAAGGAGGAGACCGAGGAAGAGCCTGAAGAC
AAA
GCCAAGGGCACAGAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGTAGCA
AG
GCAGCTGTGACCAAGGGTTCCAGCTCAGGTGCCACCCAGGACAGTGACTCCAGTGCCACCTGCAGTGC
C
GATGAGGTGGACGAACCCGAAGGAGGTGACAAGGGCAGGCTGCTGTCACCAAGGCCCAGCCTCCTCACC
CCG
GCTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGCAGCTGAAGCAGCGAG
CA
GCCGCCATCCCCCCTATCGTCACCAAGGTCCATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCC
A
GTTCCCCCTGTGCCTCCACCCACGCAGCACCTACAGCCAGAGGGTGACGTGTCTCAGCAGTCGGGAGGA
AGT
CCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAAAGAGGCAGAGAAACCCGCATTCTTTC
CG
GCTTTCCCAACTGAGGGCCCAAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCC
C
ATCCCTCCACGGGAGGTGATCAAGACTTCCCCACACGCCGCTGACCCCTCTGCCTTCTCCTACACACCC
CCC
GGTCACCCGCTGCCTCTGGGCCTCCACGATAGTGCCCGGCCCGTCCTGCCACGTCCCCCCATCTCTA
AC
CCCCCACCCCTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCCATCTCCCA
G
CAGGGGATGTCAGTCCAGCTTCGTGTGCCTCACTCAGAGCATGCCAAGGCCCCCATGGGCCCTCTCACC
ATG
GGGCTGCCCCTTGCCGTGGACCCTAAGAAGCTGGCCCCCTTCAGTGGAGTGAAGCAGGAACAGTTGT
CC
CCTCGGGGTCAGGCTGGGCCACCTGAAAGTCTGGGAGTGCCCACTGCTCAGGAGACCTCTGTGCTGAG
A
GGGACAGCACTGGGTTCCGCCACCAGTGGAAGCATCACCAAGGGCCTCCCCAGTACCCGGGCTGCAGAC
GGC
CCCAGCTACAGAGGCTCTATCACCCACGGCACGCCCGCAGACGTCCTCTACAAGGGTACCATCAGCA
GG
ATCGTCGGTGAGGACAGCCCAAGTCGCCTTGACCGGGCACGAGAGGACACCCTGCCCAAGGGCCATGT
C
ATCTATGAGGGCAAGAAAGGCCACGTCCTATCCTATGAAGGTGGTATGTCCGTGTCACAGTGCTCTAAG
GAG
GATGGAAGGAGCAGCTCGGGCCCACCCCATGAGACTGCCGCCCCTAAACGCACCTATGACATGATGG
AG
GGCCGTGTAGGCAGGACTGTCACCTCAGCCAGCATAGAGGGACTCATGGGCCGCGCCATCCCTGAGCA
G
CACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCATCACGCAAGGCATCCCGAGGTCCTAT
GTG
GAGGCGCAGGAGGACTACTTACGGCGGGAGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCC
CA
CCACCACCTCGGGACCTGACTGAGACCTACAAGCCCCGGCCCCTGGACCCTCTGGGTCCCCTGAAGCT
G
AAGCCGACTCACGAGGGTGTGGTAGCAACTGTGAAGGAGGCGGGCCGCTCTATCCATGAGATCCCGAGA
GAG
GAGCTGCGCCGCACACCTGAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATCACCCAGG
GC
ACCCCACTCAAGTACGACTCTGGGGCACCCTCCACTGGCACCAAGAAACACGACGTGCGCTCCATCAT
C
GGCAGCCCCGGCCGGCCTTTCCCTGCCCTGCACCCGCTGGACATAATGGCTGACGCCCGGGCACTGGAG
CGT
GCCTGCTATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTGCAGGGGGCTCCATCACAC
GT
GGGGCTCCAGTCGTCGTGCCTGAACTGGGCAAGCCACGGCAAAGCCCACTGACTTACGAAGACCACGG
G
GCACCCTTCACCAGTCACCTGCCACGTGGCTCCCCTGTGACCACGAGGGAGCCCACGCCACGCCTTCAG
GAA
GGCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAAGCTGACATCTACACCCCGGGAGATCGCCA
AG
TCCCCACACAGCACTGTGCCCGAGCACCACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGG
C
GTGACTGGTGTGGACCTGTACCGTGGTCACATCCCATTGGCCTTTGACCCCACCTCCATACCCCGAGGG
ATC
CCTCTGGAAGCAGCAGCCGCAGCCTACTACCTGCCCCGGCACTTGGCCCCCAGCCCCACCTACCCAC
AC
CTGTACCCACCTTACCTCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCCAGACCATCAT
C
AATGACTACATCACCTCGCAGCAGATGCACCACAACGCTGCCTCCGCCATGGCCCAGCGTGCTGACATG
CTG
AGGGGTCTGTCACCGCGAGAGTCCTCGCTGGCCCTCAATTATGCCGCTGGCCCAAGAGGCATTATCG
AC
CTGTCCCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGGCACCCCTGCCACCGCCATCGA
C
CGCCTTGCCTACCTCCCCACTGCGCCCCCACCCTTCAGCAGCCGCCACAGTAGCTCACCGCTGTCCCCA
G
GA
GGCCCCACTCACCTAGCTAAACCAACTGCCACATCTTCATCGGAGCGGGAACGGGAACGTGAGCGGG
AA
CGAGACAAGTCCATCCTCACGTCTACCACTACAGTGGAGCATGCACCCATCTGGAGACCTGGTACGGA
G
CAGAGCAGCGGGGCTGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTCGCCCATCTCCCCC
CGG
ACCCAGGACGCCTTGCAGCAGAGGCCCAGTGTGCTGCACAACACGAGCATGAAGGGCGTGGTCACCT
CC
GTGGAACCCGGCACGCCCACGGTCCTGAGGTGGGCCAGGTCCACCTCCACCTCTTCGCCTGTCCGCCC
A
GCTGCCACATTCCCACCTGCCACCCACTGCCCACTTGGTGGCACCCTTGAAGGGGTCTACCCTACCCTC
ATG
GAGCCCGTCCTGTTACCCAAGGAGACCTCTCGGGTCGCCCGGCCCGAGCGGCCCCGTGTGGACGCTG
GC
CATGCCTTCCTCACCAAACCCCCGGCCCGGGAGCCCGCCTCCTCACCCAGCAAGAGCTCCGAGCCCCG
A
TCCCTAGCACCCCCCAGCTCCAGCCACACAGCCATCGCCCGCACCCCAGCAAAGAACCTTGCACCCCAC
CAT
GCCAGTCCGGACCCGCCGGCGCCCACCTCGGCCTCAGATCTGCACCGAGAAAAGACTCAAAGTAAAC
CC
TTTTCCATCCAGGAATTGGAACTCCGTTCTCTGGGTTACCACAGTGGAGCTGGCTACAGCCCCGATGG
G
GTGGAGCCCATCAGCCCGGTGAGCTCCCCCAGCCTGACCCACGACAAGGGGCTCTCCAAACCTCTGGAA
GAG
CTAGAGAAGAGCCACTTGGAAGGGGAGCTGCGGCACAAGCAGCCAGGCCCCATGAAGCTCAGCGCGG
AG
GCTGCCCATCTCCCACATCTGCGGCCACTGCCCGAGAGCCAGCCCTCATCTAGCCCACTCCTCCAGAC
T
GCCCCAGGCATCAAAGGTCACCAGAGGGTGGTCACCTTGGCTCAGCACATCAGTGAGGTCATTACGCAG
GAC
TACACGCGCCACCACCCGCAGCAGCTCAGTGGCCCCCTTCCCGCCCCTCTCTACTCCTTTCCCGGAG
CC
AGCTGCCCTGTCCTGGATCTTCGCCGCCCACCCAGTGACCTCTACCTCCCACCCCCCGACCATGGCAC
C
CCAGCCCGGGGATCCCCCCACAGTGAAGGGGGCAAAAGGTCCCCAGAACCCAGCAAAACATCGGTCCTG
GGC
AGCAGCGAGGATGCCATTGAGCCTGTGTCCCCACCAGAGGGCATGACTGAGCCAGGACATGCTCGGA
GC
ACTGCGTACCCACTGCTGTATCGAGACGGGGAACAGGGCGAGCCCAGGATGGGCTCTAAGTCTCCAGG
C
AACACCAGCCAGCCGCCAGCCTTCTTCAGTAAGCTGACTGAGAGCAACTCCGCCATGGTGAAGTCGAAG
AAG
CAGGAGATCAACAAGAAACTCAACACCCACAACCGGAACGAGCCAGAATACAATATTGGCCAGCCTG
GG
ACGGAAATCTTCAACATGCCCGCCATCACTGGAGCAGGCCTTATGACCTGTAGAAGCCAGGCGGTGCA
A
GAACACGCCAGCACCAACATGGGGCTAGAGGCCATTATTAGAAAGGCACTCATGGGTAAATATGATCAG
TGG
GAAGAGCCCCCGCCGCTCGGCGCCAATGCTTTTAACCCTCTGAATGCCAGCGCCAGTCTGCCCGCTG
CT
GCTATGCCCATAACCACTGCTGACGGACGGAGTGACCACGCACTCACCTCGCCAGGTGGAGGTGGGAA
A
GCCAAGGTCTCTGGCAGACCTAGCAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCTAGCGTCCGGAGAC
CGA
CCCCCTTCTGTCTCCTCAGTACACTCAGAGGGGGACTGCAATCGCCGAACACCACTCACCAACCGTG
TG
TGGGAGGACCGGCCCTCATCTGCAGGGTCCACGCCATTCCCCTACAACCCTTTGATTATGAGGCTACA
G
GCAGGTGTCATGGCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGCAGCGGGCCCCTAGCTGGTCCCCAC
CAC
GCCTGGGATGAGGAGCCCAAGCCACTGCTGTGTTCACAGTATGAGACACTCTCGGACAGCGAGTGA


Translation (2332 aa):
MDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRIL
E
GLGPQVEL
PLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQRFCQRYDQLMEAWEKKVER
I
ENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQ
SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENL
E
KQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMWSEQERDTFRE
KFMQHPKNFGLIA
S
FLERK
TVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQMARSSQEEKEEKEKEKEA
D
KEEEKQDAENEKEELS
KEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQ
Q
SSEL
ASMEMNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQH
K
LKM
EKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANEEELAEEAEASQASGNEVPRVGECSG
P
AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPPEEPAVAPAEPSPVPDASGPPSPEPS
P
SPAAPPATVDKDEQEAPAAPAPQTEDAKEQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPED
K
AKGTEAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKG
RLLSPRPSLLT
P
AGDPRASTSPQKPLDLKQLKQRAAAIPPI
VTKVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGG
S
PRGKSRSPVPPAEKE
AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHAADPSAFSYTP
P
GHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQQGMSVQLRVPHSEHAKAPMGPLT
M
GLPLAVDPKKL
APFSGVKQEQLSPRGQAGPPESLGVPTAQETSVLRGTALGSATSGSITKGLPSTRAAD
G
PSYRGSITH
GTPADVLYKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEGGMSVSQCSK
E
DGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIE
GLMGRAIPEQHSPHLKEQHHIRGSITQGIPRSY
V
EAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPR
E
ELRRTPELPLAPRPLKEGSITQ
GTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMADARALE
R
ACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQ
E
GSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRG
I
PLEA
AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADM
L
RGLSPRESSLALNYAAGPR
GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSP
G
GPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPGTEQSSGAGGSSRPASHTHQHSPISP
R
TQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWA
RSTSTSSPVRPAATFPPATHCPLGGTLEGVYPTL
M
EPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKNLAPH
H
ASPDPPAPTSASDLHREKTQSKPFSIQELELRSL
GYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLE
E
LEKSHLEGELRHKQP
GPMKLSAEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRVVTLAQHISEVITQ
D
YTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGK
RSPEPSKTSVL
G
SSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEP
RMGSKSPGNTSQPPAFFSKLTESNSAMVKSK
K
QEINKKLNTHNRNEPEY
NIGQPGTEIFNMPAITGAGLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQ
W
EEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSP
GGGGKAKVSGRPSSRKAKSPAPGLASGD
R
PPSVSSVHSEGDCNRRTPLTNRVWEDRPSSA
GSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPH
H
AWDEEPKPLLCSQYETLSDSE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser