NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57300.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57300.1 Public Mus musculus 4 Bai2 16 104 75 CCDS HistoryNCBI Gene:230775Re-query CCDS DB by CCDS ID:57300.1Re-query CCDS DB by GeneID:230775

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Sequence IDs included in CCDS 57300.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000121049 ENSMUSP00000112869 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121049Link to Ensembl Protein Viewer:ENSMUSP00000112869Re-query CCDS DB by Nucleotide ID:ENSMUST00000121049Re-query CCDS DB by Protein ID:ENSMUSP00000112869
Original member Current member EBI,WTSI OTTMUST00000079294 OTTMUSP00000042283 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000079294Link to Vega Protein Viewer:OTTMUSP00000042283Re-query CCDS DB by Nucleotide ID:OTTMUST00000079294Re-query CCDS DB by Protein ID:OTTMUSP00000042283
Original member Current member NCBI NM_001199696.1 NP_001186625.1 Accepted alive Link to Nucleotide Sequence:NM_001199696.1Link to Protein Sequence:NP_001186625.1Re-query CCDS DB by Nucleotide ID:NM_001199696Re-query CCDS DB by Protein ID:NP_001186625Link to BLink:NP_001186625.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001186625.1 1506 Q8CGM1-2 1506 100% 0 0

Chromosomal Locations for CCDS 57300.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 129992069 129992879 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130005025 130005108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130006752 130006916 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130007562 130007726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130007810 130007977 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130008072 130008173 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130008323 130008429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130009211 130009405 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130009482 130009550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130009654 130009762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130010058 130010394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130011313 130011418 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130011602 130011645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130011825 130011951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130012276 130012379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130012474 130012576 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130013493 130013643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130013822 130013891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130014323 130014389 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130014551 130014636 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130014935 130015033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130017062 130017233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130017529 130017624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130017915 130017954 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130018661 130019280 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130021219 130021254 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130021563 130021661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 130022150 130022338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4521 nt):
ATGACCCCAGCCTGTCCCCTCTTACTGTCTGTGATTCTGTCCCTGCGCCTGGCCACGGCCTTCGACCCTG
CC
CCCAGTGCCTGCTCTGCCCTGGCCTCGGGCGTGCTCTACGGGGCCTTCTCGCTGCAGGACCTCTTTCC
C
ACCATCGCCTCGGGCTGCTCCTGGACCCTGGAGAACCCAGACCCCACCAAGTACTCCCTCTACCTGCGC
TTC
AACCGGCAGGAGCAGGTTTGCACACACTTTGCCCCGCGCCTGCTGCCCCTGGACCACTACCTGGTCA
AC
TTTACCTGCCTGCGGCCTGGTCCAGAGGAAGCCACAGCCCGGGCTGAGTCGGAGGTGGGACGGCCAGA
G
GAGGAGGAGGAGGAGGCGGCGGCAGCAGCATCAGGGTTGGAGTTGTGTGGTGGCTCAGGCCCCTTTACC
TTT
CTGCACTTCGACAAGAACTTTGTGCAGCTGTGCCTGTCGGCTGAGCCCTCTGAGGCCCCTCGTCTGC
TA
GCGCCTGCTGCCCTGGCCTTCCGTTTTGTGGAGGTCTTGCTGATCAACAACAACAACTCCAGCCAGTT
C
ACCTGTGGTGTGCTCTGCCGCTGGAGTGAGGAGTGTGGCCGGGCTGCAGGCAGGGCTTGTGGCTTTGCA
CAG
CCAGGGTGTAGTTGTCCTGGGGAGGCAGGGGCCAACCCCGCCACCACCACATCTCCGGGGCCTCCGG
TT
GCCCACACCCTGTCCAATGCCCTGGTGCCCGGGGGCCCAGCCCCTCCTGCTGAGGCCGACTTGCACTC
G
GGGAGCAGCAATGACCTGTTCACCACCGAGATGAGATATGGTGAGGAGCCGGAAGAGGAACCGAAGGTG
AAA
ACCCAGTGGCCAAGGTCTGCAGATGAGCCTGGGCTATACATGGCGCAGACAGTGCACGGCGTGTGGG
AG
GAGTGGGGGTCCTGGAGCCTGTGCTCCCGCAGCTGCGGGCGGGGGTCTCGGAGCCGGATGCGGACCTG
C
GTGCCCCCCCAGCACGGCGGCAAGGCCTGCGAGGGTCCCGAGCTGCAGACTAAACTCTGCAGTATGGCC
GCC
TGCCCGGTGGAAGGCCAGTGGCTAGAATGGGGTCCCTGGGGCCCATGCTCATCATCTTGTGCCAATG
GG
ACCCAGCAGCGCAGCCGGAAATGCAGTGTGGCGGGTCCAGCCTGGGCCACGTGCGCAGGTGCCCTCAC
G
GATACCCGTGAGTGCAGCAATCTCGATTGCCCGGCCACTGACGGCAAGTGGGGGCCGTGGAACGCGTGG
AGC
CTGTGCTCCAAGACGTGTGACACGGGCTGGCAACGCCGCTTCCGCATGTGCCAGGCTTCTGGCACAC
AG
GGCTACCCTTGCGAGGGCACAGGAGAGGAGGTGAAACCCTGCAGTGAGAAGAGGTGTCCAGCCTTCCA
T
GAGATGTGCAGGGATGAGTACGTGATGTTGATGACATGGAAGAGGGCGGCAGCTGGCGAGATCATTTAC
AAC
AAGTGTCCCCCTAATGCCTCGGGTTCTGCTAGCCGCCGCTGTCTCCTCAGTGCCCAGGGCGTAGCAT
AC
TGGGGACTGCCCAGCTTTGCTCGTTGCATATCCCATGAATACCGCTACCTGTACCTGTCACTTCGGGA
A
CACCTGGCTAAGGGCCAGCGCATGCTGGCAGGTGAGGGCATGTCACAGGTGGTGCGGAGCCTGCAGGAG
CTA
CTGGCACGGCGCACTTACTACAGCGGGGACCTGCTCTTCTCTGTGGACATCCTAAGGAACGTCACTG
AC
ACCTTCAAGAGGGCCACCTATGTCCCTTCCGCCGATGACGTGCAGCGTTTCTTCCAGGTGGTGAGCTT
C
ATGGTGGATTCAGAAAACAAGGACAAATGGGATGATGCTCAGCAGGTGTCACCGGGCTCTGTGCACCTG
CTG
CGTGTTGTGGAAGATTTCATTCACCTCGTGGGCGACGCTCTCAAGGCCTTCCAGAGCTCTCTCATTG
TC
ACGGACAATCTGGTGATCAGCATTCAGAGAGAGCCTATCTCCGCCGTGTCCAGTGACATCACGTTTCC
C
ATGCGGGGCCGCAGGGGCATGAAGGACTGGGTGCGACACTCAGAGGATCGTCTCTTTCTACCCAAGGAG
GTG
CTCAGCCTGTCCTCCCCAGGAAAGCCAGCCACACCTGGGGCAGCCACAGCAGGCAGCCCGGGCAGGG
GG
AGGGGCCCAGGAACGGTGCCCCCTGGCCCAGGCCACGCCCACCAGCGCCTTCTCCCAGCTGACCCCGA
A
GAGTCCTCCTCCTACTTTGTGATCGGTGCTGTGCTCTACCGCACCCTTGGCCTCATCCTGCCGCCCCCC
AG
G
CCTCCACTTGCTGTCACCTCCCGGGTGATGACAGTGACTGTGCGTCCCCCCACCCAGCCTCCAGCTG
AG
CCCCTCATTACAGTGGAACTCTCGTACATCATCAATGGCACCACCGATCCCCACTGTGCCAGCTGGGA
C
TACTCCAGAGCAGATACCAACTCGGGGGACTGGAACACTGAGAGCTGCCAGACCTTGGAGACCCAGGCG
GCT
CACACCCGCTGCCAGTGCCAGCACCTGTCCACCTTTGCCGTCCTGGCCCAGCCACCCAAGGACCTGA
CC
CTGGAGCTGGCAGGTGCTCCCTCTGTCCCCCTGGTGATCGGCTGTGCAGTGTCCTGCATGGCTCTGCT
C
ACCCTGCTGGCCATCTATGCAGCCTTCTGGAGGTTTATAAAATCAGAACGCTCCATCATCTTGCTGAAC
TTC
TGCCTGTCCATCCTGGCTTCCAACATTCTGATCCTGGTGGGCCAGTCCCGGGTGCTGAGCAAGGGCG
TA
TGCACCATGACGGCTGCCTTCCTACACTTCTTCTTTCTGTCCTCCTTTTGCTGGGTGCTTACAGAGGC
C
TGGCAATCCTATCTGGCTGTCATCGGGCGGATGCGCACCCGCCTGGTTCGCAAGCGCTTCCTCTGCCTG
GGC
TGGGGTCTACCTGCCCTGGTGGTGGCTGTGTCTGTTGGCTTTACTCGCACCAAAGGATATGGTACAT
CC
AGCTACTGCTGGCTGTCCCTAGAGGGCGGCCTGCTCTATGCCTTCGTGGGTCCAGCAGCAGTCATTGT
C
CTGGTGAACATGCTCATCGGGATTATCGTCTTCAACAAGCTCATGGCTCGCGATGGCGTCTCAGACAAA
TCT
AAGAAGCAGAGGGCTGGGTCGGAGCGGTGCCCCTGGGCCAGCCTGCTCCTTCCCTGCTCAGCGTGTG
GA
GCGGTCCCCAGCCCCCTGCTCAGCTCAGCCTCGGCCAGGAATGCCATGGCTTCACTCTGGAGTTCCTG
C
GTGGTACTGCCTCTCCTGGCGCTTACCTGGATGTCTGCCGTCCTGGCCATGACAGATCGCCGCTCCGTC
CTC
TTCCAGGCACTCTTTGCCGTTTTCAACTCTGCACAAGGCTTTGTCATCACCGCTGTGCACTGCTTCC
TG
CGCCGAGAGGTCCAGGATGTGGTAAAGTGTCAGATGGGTGTGTGTCGGGCTGATGAGAGTGAAGACTC
C
CCAGACTCGTGCAAGAACGGGCAGCTGCAGATCCTGTCAGACTTTGAAAAGGACGTGGATCTGGCTTGT
CAG
ACAGTTCTGTTCAAGGAGGTCAACACCTGCAACCCGTCCACCATTACCGGCACTCTGTCCCGCCTGT
CT
CTGGATGAGGATGAGGAGCCCAAGTCCTGTCTCGTGGGTCCTGAGGGTGGCCTCAGCTTCTCACCACT
G
CCTGGGAACATCCTGGTACCCATGGCAGCCTCACCAGGTCTAGGGGAGCCACCACCACCCCAGGAGACC
AAC
CCTGTGTACATGTGTGGGGAGGGTGGCCTGCGGCAGTTGGACCTTACATGGATACGGCAGAGTGAAC
CA
GGCTCTGAGGGGGACTACATGGTTCTGCCCCGGCGGACTTTGAGCCTGCAGCCTGGTGGTGGGGGTAC
A
GCGGGTGAGGAGGCCCCAAGGGCCCGGCCTGAGGGGACCCCCCGGCGGGCTGCCAAAACGGTAGCCCAC
ACT
GAAGGCTACCCCAGCTTCCTGTCTGTGGAGCACTCGGGTCTAGGGCTGGGCCCTGCCTATGGGTCTC
TC
CAGAACCCGTATGGAATGACCTTCCAACCACCACCACCAACACCCAGCGCCCGCCAAGTACCAGAGCC
A
GGAGAACGTAGCCGGACCATGCCCCGTACAGTGCCTGGTTCCACCATGAAGCTGGGCTCCCTTGAGCGA
AAG
AAGCTTCGGTATTCGGACTTGGACTTTGAGAAGGTGATGCACACTCGGAAACGGCACTCGGAACTCT
AC
CACGAACTCAACCAGAAGTTCCACACTTTCGACCGCTACCGTAGCCAGTCCTCAGCCAAGGAGAAACC
C
AGCCCCCCCGGGGGACGCCCTGGCTTGTCCCAGCACAGGAGGCATCAAAGCTGGAGCACCTTCAAATCT
ATG
ACACTGGGCTCACTGCCCCCCAAGCCCCGAGAACGGCTGGCCCTGCACCGGACAGCAGCCTGGGAGC
CC
ACAGAACCGCCAGACGGCGACTTCCAGACAGAGGTGTGA


Translation (1506 aa):
MTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLR
F
NRQEQVCTHFAPRLLPLDHYLVNFTCLRPGPEEATARAESEVGRPEEEEEEAAAAASGLELCGGSGPFT
F
LHFDKNFVQLCLSAEPSEAPRLLAPAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFA
Q
PGCSCPGEAGANPATTTSPGPPVAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRY
GEEPEEEPKV
K
TQWPRSADEPGLYMAQT
VHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMA
A
CP
VEGQWLEWGPWGPCSSSCANGTQQRSRKCSVAGPAWATCAGALTDTRECSNLDCPATDGKWGPWNAW
S
LCSKTCDTGWQRRFRMCQASGTQGYPCEGTGEEVKPCSEKRCP
AFHEMCRDEYVMLMTWKRAAAGEIIY
N
KCPPNAS
GSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQE
L
LARRTYYSGDLLFSVDILRNVTDTFKRATYVPSADDVQ
RFFQVVSFMVDSENKDKWDDAQQVSPGSVHL
L
RVVEDFIHLVGDALKAFQSSLIVTDNL
VISIQREPISAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKE
V
LSLSSPGKPATPGAATAGSPGRGRGPGTVPPGPGHAHQRLLPADPEESSSYFVIGAVLYRTLGLILPPP

R
PPLAVTSRVMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADTNSGDWNTESCQTLETQA
A
HTRCQCQHLSTFAVLAQPPKDL
TLELAGAPSVPLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLN
F
CLSILASNILILVGQSRVLSK
GVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCL
G
W
GLPALVVAVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGVSDK
S
KKQRA
GSERCPWASLLLPCSACGAVPSPLLSSASARNAMASLWSSCVVLPLLALTWMSAVLAMTDRRSV
L
FQALFAVFNSAQGFVITAVHCFLRRE
VQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDFEKDVDLAC
Q
T
VLFKEVNTCNPSTITGTLSRLSLDEDEEPKSCLVGPEGGLSFSPLPGNILVPMAASPGLGEPPPPQET
N
PVYMCGEGGLRQLDLTWIRQSEPGSEGDYMVLPRRTLSLQPGGGGTAGEEAPRARPEGTPRRAAKTVAH
T
EGYPSFLSVEHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKLGSLE
R
K
KLRYSDLDFE
KVMHTRKRHSELYHELNQKFHTFDRYRSQSSAKEKPSPPGGRPGLSQHRRHQSWSTFKS
M
TLGSLPPKPRERLALHRTAAWEPTEPPDGDFQTEV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser