NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS53108.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53108.1 Public Mus musculus X Ikbkg 16 104 75 CCDS HistoryNCBI Gene:16151Re-query CCDS DB by CCDS ID:53108.1Re-query CCDS DB by GeneID:16151See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 53108.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000004330 ENSMUSP00000004330 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000004330Link to Ensembl Protein Viewer:ENSMUSP00000004330Re-query CCDS DB by Nucleotide ID:ENSMUST00000004330Re-query CCDS DB by Protein ID:ENSMUSP00000004330
Original member Current member NCBI NM_001136067.2 NP_001129539.1 Accepted alive Link to Nucleotide Sequence:NM_001136067.2Link to Protein Sequence:NP_001129539.1Re-query CCDS DB by Nucleotide ID:NM_001136067Re-query CCDS DB by Protein ID:NP_001129539Link to BLink:NP_001129539.1

Chromosomal Locations for CCDS 53108.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 74427864 74427902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74432805 74433006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74433803 74434014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74437164 74437282 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74438907 74439059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74439875 74439950 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74443345 74443488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74443772 74443914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74447859 74447920 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 74448217 74448359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1293 nt):
ATGTATATCAGGTACTGCTGTGATGATCAGGACACACAGACACTGTCCTGTTGGATGAACAAGCACCCCT
GG
AAGAACCAGCTGAGTGAGATGGTGCAGCCCAGTGGTGGCCCAGCAGAGGACCAGGACATGCTGGGTGA
A
GAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCCTTCAGAGCAGGGTACTCCTGAGACCCTCCAG
CGC
TGCCTGGAAGAGAATCAAGAGCTCCGAGACGCTATCCGGCAGAGCAATCAGATGCTGAGGGAACGCT
GT
GAGGAGCTGCTGCATTTCCAGGTCAGCCAGCGGGAGGAGAAGGAGTTCCTTATGTGCAAATTCCAGGA
A
GCCCGGAAGCTGGTGGAGAGACTGAGCTTGGAGAAGCTTGATCTTCGGAGTCAGAGGGAACAGGCCTTA
AAG
GAGTTGGAGCAACTGAAGAAATGCCAACAGCAGATGGCTGAGGACAAGGCCTCTGTGAAAGCTCAGG
TG
ACATCATTGCTCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCAAGGATCGGCAAGC
T
TTAGAGGGAAGGATTCGAGCAGTTAGTGAGCAGGTCAGACAGCTGGAGAGTGAGCGGGAGGTGCTACAG
CAG
CAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGAGCGTGGAGGCTGCCTTGCGAATGG
AG
CGGCAGGCTGCTTCAGAGGAGAAGCGGAAGCTGGCTCAGTTGCAGGCAGCCTATCACCAGCTCTTCCA
A
GACTACGACAGCCACATTAAGAGCAGCAAGGGCATGCAGCTGGAAGATCTGAGGCAACAGCTCCAGCAA
GCT
GAGGAGGCCCTGGTAGCCAAACAGGAATTGATTGATAAGCTGAAAGAGGAGGCTGAGCAGCACAAGA
TT
GTGATGGAGACTGTGCCAGTCTTGAAGGCCCAGGCGGATATCTACAAGGCTGACTTCCAAGCTGAGAG
G
CATGCCCGGGAGAAGCTGGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCAGCTGCAGCGCGAG
TTC
AACAAGCTGAAAGTTGGCTGCCATGAGTCAGCCAGGATTGAGGATATGAGGAAGCGGCATGTAGAGA
CT
CCCCAGCCTCCTTTACTCCCTGCTCCAGCTCACCACTCCTTTCATTTGGCCTTGTCCAACCAGCGGAG
G
AGCCCTCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCCTGATATGGACACT
CTA
CAGATACATGTCATGGAGTGCATAGAGTAG


Translation (430 aa):
MYIRYCCDDQDTQTLSCWMNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQ
R
CLEENQELR
DAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQAL
K
ELEQLKKCQQ
QMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGRIRAVSEQVRQLESEREVLQ
Q
QHSVQVDQLRMQNQSVEAALRMERQAASEE
KRKLAQLQAAYHQLFQDYDSHIKSSKGMQLEDLRQQLQQ
A
EEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQ
ADIYKADFQAERHAREKLVEKKEYLQEQLEQLQRE
F
NKLKVGCHESA
RIEDMRKRHVETPQPPLLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDT
L
QIHVMECIE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser