NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS53089.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53089.1 Public Mus musculus X Mtm1 16 104 75 CCDS HistoryNCBI Gene:17772Re-query CCDS DB by CCDS ID:53089.1Re-query CCDS DB by GeneID:17772

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 53089.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101501 ENSMUSP00000099040 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101501Link to Ensembl Protein Viewer:ENSMUSP00000099040Re-query CCDS DB by Nucleotide ID:ENSMUST00000101501Re-query CCDS DB by Protein ID:ENSMUSP00000099040
Original member Current member EBI,WTSI OTTMUST00000043207 OTTMUSP00000019437 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043207Link to Vega Protein Viewer:OTTMUSP00000019437Re-query CCDS DB by Nucleotide ID:OTTMUST00000043207Re-query CCDS DB by Protein ID:OTTMUSP00000019437
Original member Current member NCBI NM_001164193.1 NP_001157665.1 Accepted alive Link to Nucleotide Sequence:NM_001164193.1Link to Protein Sequence:NP_001157665.1Re-query CCDS DB by Nucleotide ID:NM_001164193Re-query CCDS DB by Protein ID:NP_001157665Link to BLink:NP_001157665.1

Chromosomal Locations for CCDS 53089.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 71231399 71231461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 71233072 71233144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 71234852 71234946 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 71254251 71254361 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 71259725 71259826 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 71260570 71260614 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (489 nt):
ATGGCTTCTGCATCAGCATCTAAGTATAATTCACACTCCTTGGAGAATGAATCCATTAAGAAAGTGTCTC
AA
GATGGAGTCAGTCAGGATGTGAGTGAGACTGTCCCTCGGCTCCCAGGGGAGTTACTAATTACTGAAAA
A
GAAGTTATTTACATATGTCCTTTCAATGGCCCCATTAAGGGAAGAGTTTACATCACAAATTATCGTCTT
TAT
TTAAGAAGTTTGGAAACGGATTCTGCTCTAATACTTGATGTTCCTCTGGGTGTGATATCAAGAATTG
AA
AAAATGGGAGGCGCGACAAGTAGAGGAGAAAATTCCTATGGTCTAGATATTACTTGTAAAGATTTGAG
A
AACCTGAGGTTTGCATTGAAGCAAGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTTGTAAAACAT
GCC
TTTCCTCTGGCACACAATCTGGCTAACCTGAAACTCATGATCCTGTTACCTCGACCTCCTGAATGA


Translation (162 aa):
MASASASKYNSHSLENESIKKVSQDGVSQDVSETVPRLPGELLITEKEVIYICPFNGPIKGRVYITNYRL
Y
LRSLET
DSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLRFALKQEGHSRRDMFEILVKH
A
FPLAHNL
ANLKLMILLPRPPE



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser