NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52917.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52917.1 Public Mus musculus 9 Cacna2d2 16 104 75 CCDS HistoryNCBI Gene:56808Re-query CCDS DB by CCDS ID:52917.1Re-query CCDS DB by GeneID:56808See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 52917.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000010210 ENSMUSP00000010210 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000010210Link to Ensembl Protein Viewer:ENSMUSP00000010210Re-query CCDS DB by Nucleotide ID:ENSMUST00000010210Re-query CCDS DB by Protein ID:ENSMUSP00000010210
Original member Current member EBI,WTSI OTTMUST00000094609 OTTMUSP00000052655 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000094609Link to Vega Protein Viewer:OTTMUSP00000052655Re-query CCDS DB by Nucleotide ID:OTTMUST00000094609Re-query CCDS DB by Protein ID:OTTMUSP00000052655
Original member Current member NCBI NM_001174050.1 NP_001167521.1 Accepted alive Link to Nucleotide Sequence:NM_001174050.1Link to Protein Sequence:NP_001167521.1Re-query CCDS DB by Nucleotide ID:NM_001174050Re-query CCDS DB by Protein ID:NP_001167521Link to BLink:NP_001167521.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001167521.1 1148 Q6PHS9-2 1148 100% 0 0

Chromosomal Locations for CCDS 52917.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 107400069 107400283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107426053 107426134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107465553 107465669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107497460 107497519 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107505948 107505992 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107509195 107509336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107512001 107512132 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107512303 107512360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107513054 107513104 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107513233 107513332 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107513473 107513631 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107513835 107513942 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107514045 107514123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107514632 107514681 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107514860 107514949 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107515151 107515222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107515419 107515493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107517095 107517169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107517251 107517322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107517413 107517484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107517591 107517652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107518193 107518269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107522123 107522183 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107524095 107524192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107524398 107524488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107524612 107524674 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107524831 107524934 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107525157 107525255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107525344 107525432 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107525610 107525660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107525901 107525972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107526063 107526215 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107526343 107526395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107526485 107526540 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107526688 107526814 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107526937 107527046 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107527154 107527236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 107527321 107527464 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3447 nt):
ATGGCGGTGCCGGCTCGGACCTGCGGCGCTTCTTGGCCCGGCCCGGTGCGGACCGCTCGCCCCTGGCCCG
GT
CGCGGCCCCCGGCCCTGCCCTGACCCCCGGGGCCCAGCGTCCGGGCCCGCACGCCCGCTCTTGCTCTT
G
CTGCCGCCTCTGTTGCTTTTACCGCTGCTCACCGCCCCCGGCGCCTCTGCCTACAGCTTCCCCCAGCAG
CAC
ACGATGCAGCACTGGGCCCGGCGCCTGGAGCAGGAGATTGACGGTGTGATGCGGATTTTTGGAGGCG
TG
CAGCAGCTCCGAGAGATCTACAAGGACAATCGGAACCTGTTTGAAGTGCAGGAGAATGAACCACAGAA
A
TTGGTGGAGAAAGTGGCAGGGGACATCGAGAGCCTGCTGGACAGGAAGGTCCAGGCCCTGAAGAGACTG
GCT
GACGCTGCAGAGAATTTCCAGAAAGCCCATCGCTGGCAGGACAACATCAAGGAGGAAGACATCATGT
AC
TACGATGCCAAGGCTGACGCCGAGCTGGATGACCCTGAGAGTGAAGATATGGAGAGGGGATCCAAGAC
C
AGCGCCTTAAGGCTGGACTTCATCGAGGACCCAAACTTCAAGAACAAAGTCAACTATTCATACACGGCT
GTG
CAGATCCCCACAGACATCTACAAAGGCTCTACCGTCATCCTCAATGAGCTTAACTGGACAGAGGCCC
TG
GAGAACGTCTTCATTGAGAACCGTAGGCAAGACCCTACACTGTTGTGGCAAGTCTTTGGCAGTGCCAC
G
GGAGTCACTCGCTATTACCCAGCCACACCATGGCGAGCCCCCAAGAAGATTGACCTGTACGATGTCAGA
AGA
CGACCCTGGTATATACAGGGGGCCTCATCACCCAAGGACATGGTCATCATTGTGGATGTGAGTGGCA
GC
GTGAGCGGCCTGACTCTGAAGCTGATGAAGACGTCCGTCTGTGAGATGCTAGACACGCTCTCTGATGA
T
GACTATGTGAACGTGGCCTCATTCAACGAGAAGGCGCAGCCTGTGTCTTGCTTCACACACCTGGTGCAG
GCC
AATGTGCGTAACAAGAAGGTGTTCAAGGAAGCTGTGCAGGGCATGGTGGCCAAGGGCACCACAGGCT
AC
AAGGCCGGCTTTGAGTATGCCTTTGACCAGCTACAGAATTCCAACATCACGCGGGCTAACTGCAATAA
G
ATGATCATGATGTTCACGGATGGGGGTGAGGATCGCGTGCAGGATGTCTTCGAAAAGTACAATTGGCCC
AAT
CGGACGGTACGTGTGTTCACGTTCTCCGTAGGACAGCATAACTATGATGTCACACCCTTGCAGTGGA
TG
GCCTGTACTAACAAAGGTTACTATTTTGAGATCCCTTCCATCGGAGCCATCCGCATCAACACACAGGA
A
TACCTGGATGTGCTGGGTAGGCCCATGGTACTGGCAGGCAAGGACGCCAAGCAAGTGCAATGGACAAAC
GTG
TATGAAGATGCACTGGGGCTGGGGTTGGTGGTAACAGGAACTCTCCCTGTTTTCAACCTGACACAGG
AT
GGCCCTGGGGAAAAGAAGAACCAGTTAATCCTGGGTGTCATGGGCATCGATGTGGCCTTGAATGACAT
C
AAAAGGCTGACTCCCAACTACACACTCGGCGCCAATGGCTATGTGTTCGCCATCGACCTGAACGGCTAC
GTG
TTGCTACATCCCAATCTCAAGCCCCAGACTACCAACTTCCGGGAGCCTGTGACCTTGGACTTCCTGG
AC
GCAGAGCTGGAAGATGAGAACAAGGAGGAGATCCGTCGCAGCATGATTGACGGCGACAAAGGCCACAA
G
CAGATCAGAACCTTGGTCAAATCCCTGGATGAGAGGTACATAGACGAAGTGATTCGGAACTACACCTGG
GTG
CCTATAAGGAGTACCAACTACAGCCTGGGGCTGGTGCTCCCACCCTACAGCACCTACTACCTCCAAG
CC
AACCTCAGCGACCAGATCCTGCAGGTCAAGTATTTTGAGTTCCTGCTTCCCAGCAGCTTTGAGTCTGA
A
GGACACGTTTTCATTGCTCCGAGAGAGTATTGCAAGGACTTGAACGCCTCGGACAACAACACCGAGTTC
CTG
AAGAACTTCATCGAGCTCATGGAGAAAGTGACTCCGGACTCCAAGCAGTGTAATAACTTCCTTCTTC
AT
AACTTGATTCTGGACACGGGCATTACACAGCAGTTAGTGGAACGTGTGTGGCGGGACCAAGATCTCAA
C
ACGTACAGCCTGCTAGCCGTATTTGCTGCCACTGATGGTGGCATCACACGTGTCTTCCCGAACAAGGCA
GCC
GAAGACTGGACAGAAAACCCTGAACCCTTCAATGCCAGCTTCTACCGTCGCAGCCTGGATAACCATG
GT
TATATCTTCAAGCCCCCACACCAGGACTCCCTGTTAAGACCACTGGAGCTGGAGAATGACACAGTAGG
T
GTCCTCGTCAGCACAGCTGTGGAGCTCAGTCTAGGTCGTCGCACACTGAGGCCAGCAGTGGTGGGTGTC
AAA
CTGGACCTAGAGGCTTGGGCTGAAAAGTTCAAGGTGCTGGCCAGCAACCGTACCCATCAGGACCAAC
CT
CAGAAGCAGTGCGGCCCCAGCAGCCACTGTGAGATGGACTGCGAGGTTAACAACGAGGATCTACTCTG
T
GTCCTCATTGATGACGGAGGGTTCCTGGTGCTGTCAAACCAGAACCATCAGTGGGACCAGGTTGGCAGA
TTC
TTCAGTGAGGTGGATGCCAACCTGATGCTGGCACTGTACAATAACTCCTTCTACACCCGAAAGGAAT
CC
TATGACTATCAGGCAGCCTGTGCCCCTCAGCCTCCTGGGAACCTGGGTGCTGCACCCCGGGGTGTCTT
T
GTGCCCACCATTGCAGATTTCCTTAACTTGGCCTGGTGGACCTCTGCTGCCGCCTGGTCCTTATTCCAG
CAG
CTACTCTATGGTCTCATCTATCACAGCTGGTTCCAGGCAGACCCGGCAGAAGCTGAGGGCAGCCCCG
AG
ACGCGCGAGAGCAGCTGCGTCATGAAACAGACCCAGTACTACTTCGGCTCGGTGAACGCATCCTATAA
T
GCCATCATTGACTGCGGAAACTGCAGCAGGCTGTTCCATGCGCAGAGACTGACCAACACCAATCTCCTG
TTC
GTGGTGGCCGAGAAGCCGCTGTGCAGCCAGTGCGAGGCGGGCCGGCTGCTGCAGAAGGAGACACACT
CG
GACGGCCCGGAGCAGTGTGAGCTGGTGCAGAGACCGAGATACCGAAGAGGTCCGCACATCTGTTTTGA
C
TACAATGCGACGGAAGATACCTCAGACTGTGGCCGCGGAGCCTCCTTCCCTCCGTCGCTGGGCGTCTTG
GTT
TCCTTGCAGCTTTTGCTCCTCCTGGGCCTGCCACCTCGGCCGCAGCCTCAAGTCCACTCCTTCGCTG
CC
TCTCGCCACCTCTGA


Translation (1148 aa):
MAVPARTCGASWPGPVRTARPWPGRGPRPCPDPRGPASGPARPLLLLLPPLLLLPLLTAPGASAYSFPQQ
H
TMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRL
A
DAAENFQKAHRWQDNIK
EEDIMYYDAKADAELDDPESEDMERGSKTSALRLDFIEDPNFKNKVNYSYTA
V
QIPTDIYKG
STVILNELNWTEALENVFIENRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVR
R
RP
WYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQ
A
NVRNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQN
SNITRANCNKMIMMFTDGGEDRVQDVFEKYNWP
N
RT
VRVFTFSVGQHNYDVTPLQWMACTNKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKDAKQVQWTN
V
YEDAL
GLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGY
V
LLHPNLKPQ
TTNFREPVTLDFLDAELEDENKEEIRRSMIDGDKGHKQIRTLVKSLDERYIDEVIRNYTW
V
PIRSTNY
SLGLVLPPYSTYYLQANLSDQILQVKYFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEF
L
KNFIELMEKVTPDSKQ
CNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKA
A
EDWTENPEPFNASFYRRSLDNHGYIFKPPHQD
SLLRPLELENDTVGVLVSTAVELSLGRRTLRPAVVGV
K
LDLEAWAEKFKVLASNRTHQDQPQK
QCGPSSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGR
F
FSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVFV
PTIADFLNLAWWTSAAAWSLFQ
Q
LLYGLIYHSWFQA
DPAEAEGSPETRESSCVMKQTQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLL
F
VVAEKPLCSQCEAGRLLQKETH
SDGPEQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVL
V
SLQLLLLLGLPPRPQPQVHSFAASRHL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser